KEGG   Meriones unguiculatus (Mongolian gerbil): 110543676
Entry
110543676         CDS       T05884                                 

Gene name
Bak1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04141  Protein processing in endoplasmic reticulum
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05160  Hepatitis C
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05203  Viral carcinogenesis
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05216  Thyroid cancer
mun05217  Basal cell carcinoma
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110543676 (Bak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110543676 (Bak1)
   04215 Apoptosis - multiple species
    110543676 (Bak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110543676 (Bak1)
   05202 Transcriptional misregulation in cancer
    110543676 (Bak1)
   05206 MicroRNAs in cancer
    110543676 (Bak1)
   05203 Viral carcinogenesis
    110543676 (Bak1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110543676 (Bak1)
   05212 Pancreatic cancer
    110543676 (Bak1)
   05225 Hepatocellular carcinoma
    110543676 (Bak1)
   05226 Gastric cancer
    110543676 (Bak1)
   05214 Glioma
    110543676 (Bak1)
   05216 Thyroid cancer
    110543676 (Bak1)
   05220 Chronic myeloid leukemia
    110543676 (Bak1)
   05217 Basal cell carcinoma
    110543676 (Bak1)
   05218 Melanoma
    110543676 (Bak1)
   05213 Endometrial cancer
    110543676 (Bak1)
   05224 Breast cancer
    110543676 (Bak1)
   05222 Small cell lung cancer
    110543676 (Bak1)
   05223 Non-small cell lung cancer
    110543676 (Bak1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    110543676 (Bak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110543676 (Bak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110543676 (Bak1)
   05160 Hepatitis C
    110543676 (Bak1)
   05164 Influenza A
    110543676 (Bak1)
   05162 Measles
    110543676 (Bak1)
   05168 Herpes simplex virus 1 infection
    110543676 (Bak1)
   05163 Human cytomegalovirus infection
    110543676 (Bak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110543676 (Bak1)
   05169 Epstein-Barr virus infection
    110543676 (Bak1)
   05165 Human papillomavirus infection
    110543676 (Bak1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110543676 (Bak1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mun03029]
    110543676 (Bak1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mun02000]
    110543676 (Bak1)
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    110543676 (Bak1)
Transporters [BR:mun02000]
 Other transporters
  Pores ion channels [TC:1]
   110543676 (Bak1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 110543676
NCBI-ProteinID: XP_021485608
LinkDB
Position
Unknown
AA seq 278 aa
MVTKSRGFLGRDDPWRRHLDTGNSDAGPCKSGLKPCPWRKPAAPRDSVSRPLSQPTSGAE
SGETCPPRPDRWHLDKDQVLRERAVKSLPPLLQVARDTEEVFRSYVFYLHHQEQETQGAA
APANPEMDNLSLEPNSVLGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTK
IASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILRHYIARWIAQ
RGGWVAALNLRRDPILIVMTIFGVVVLGQFVIHRFFRS
NT seq 837 nt   +upstreamnt  +downstreamnt
atggtcacaaagtcgcgaggcttcctgggccgagacgacccgtggcggcggcatctcgac
accgggaattcagacgccggtccctgcaagtcaggcctgaaaccttgcccctggaggaag
ccagcagcccctcgggattctgtctccagaccgctgagccagcccacatctggagcagag
tccggtgagacctgtccacccagacctgacagatggcatctggacaaggaccaggtcctc
cgagagagggctgtgaagagcctccctccccttctgcaggtagcccgggacacagaggag
gtctttcgaagctacgttttttacctccaccaccaggagcaagagacccagggagcggct
gcccctgccaaccccgagatggacaacctgtccctagaacccaatagtgtcttgggtcag
gtgggtcggcagctcgcgctcatcggagatgacattaaccggcgctatgacaccgagttc
cagaatttactggaacagcttcagcccaccgccgggaacgcctatgaactcttcaccaag
atcgcctccagcctgtttaagagcggcatcagctggggccgtgtggtggctctcctgggc
ttcggctaccgcctggccctgtatgtctaccagcgtggtctgaccggcttcctgggccag
gtgacctgctttctggctgacatcatacttcgccactacattgccaggtggatcgcgcag
agaggcggctgggtggcagccctgaatctgcgcagagaccccatcctgatcgtaatgacc
atttttggcgtggttgtgttgggccagttcgtgatacaccgattcttcagatcctga

DBGET integrated database retrieval system