KEGG   Meriones unguiculatus (Mongolian gerbil): 110543786
Entry
110543786         CDS       T05884                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha-like isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04630  JAK-STAT signaling pathway
mun04640  Hematopoietic cell lineage
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110543786
   04151 PI3K-Akt signaling pathway
    110543786
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110543786
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110543786
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110543786
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110543786
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110543786
   04090 CD molecules [BR:mun04090]
    110543786
Cytokine receptors [BR:mun04050]
 Interleukin receptor families
  IL3 receptor family
   110543786
CD molecules [BR:mun04090]
 Proteins
  110543786
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N
Other DBs
NCBI-GeneID: 110543786
NCBI-ProteinID: XP_021485682
LinkDB
Position
Unknown
AA seq 455 aa
MARIPRHRDMLPLLLSSRACHLWKRPGGGRSDRGTRKSGTRARGPVSRPPMSSCVPPPTM
ATVLWLLLALTGSLMSSDPGPAPLATPFRNLHLDPERLLLSWEQVTPTPQPACRKWRRGD
REEAATVVFAEVGRPRCSFRSLSHCHMTEFSVSLPSNHSVARATLLFPEADGDRAAAATP
PRCQVDLATGMTCRWGPGPRAPRDVQYRMFWRDAAQGRNRDRECPRYDVMEGGTRLGCVL
ENVTVLPSYITVTVTGSAGGGTEVPCSDSSVDLQLVEVVAPPNVSATCNGSVSAFVHWEV
QSVFHRNFEFQLEMRRNSQLEPEIETTEERHFWVVNPGTLSVRVRARPVAAEEFGMWSDV
QHLDCDPRRNGLTRMVVSLAAVGAGLTGLGATLLLCRRRGLSRKLFPPIPHVKDPTVAEG
EVVDSVTWWARPEEEECEVTSVTEAGPRLSIISRS
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggctcggatccccaggcatagggatatgttgccgttgctgttgtcatcacgtgcctgt
catctctggaaacggcccggcggggggcggagcgaccgcggaacaaggaagtcggggacc
cgggcgcgggggccagtctctaggcccccaatgtcctcctgtgtgcccccgcccaccatg
gccactgtcctctggctgctcctggcactcactggttcactgatgtcctctgatcccggt
cctgcccccttggctacgcccttccggaacctgcacctggaccccgagcgtctcctcctc
tcctgggagcaggtcacgcccacccctcagcctgcctgccggaagtggaggcgcggggac
agggaggaggcagcgacagtggtctttgcagaagtggggcgtccccgctgttccttccga
tccctttcgcactgtcacatgaccgagttctccgtctccctgcccagtaatcacagtgtg
gccagagctaccctcctcttcccggaagcagatggcgaccgcgcagcagcagccacgccc
cctcgctgccaggtggatcttgcgaccgggatgacgtgccgctggggaccggggccccga
gcgccccgagacgtgcagtaccggatgttctggagggatgcagcacaggggcggaaccgg
gaccgtgagtgcccgcgctatgacgtcatggagggcggaacccgcctgggctgtgtcctg
gaaaatgtcactgtgctgccgtcctacatcactgtcactgtgacagggagtgctggaggc
gggacggaagtgccgtgcagtgactcctctgtggacctgcagctcgtggaggttgtggct
ccacccaatgtgagtgccacgtgcaatgggtcagtgtctgccttcgtgcactgggaagtg
cagagcgtcttccaccgcaacttcgagttccagttggagatgcgaaggaactcacaactg
gaacctgagattgagacgacagaggagcgccacttctgggtcgtgaatccggggaccctc
tctgtccgggtcagggcgaggccagtagctgctgaggagttcggcatgtggagtgatgtg
cagcacctggactgtgaccccagaaggaacggcctgaccaggatggtggtgtcactggct
gctgtgggggcagggctcactgggttgggggccaccctgctgctgtgtcgcaggcgcggc
ctgagccggaagctgttcccgcctatcccccacgtgaaggacccgacagtggcagaaggg
gaagtggtggactcggtcacgtggtgggcgaggccggaagaggaagagtgtgaggtgaca
tcggtgacagaggcggggccgcgcctgtcaatcatctcccgttcatag

DBGET integrated database retrieval system