KEGG   Meriones unguiculatus (Mongolian gerbil): 110544010
Entry
110544010         CDS       T05884                                 

Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4E-like
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110544010
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mun04054]
    110544010
Membrane trafficking [BR:mun04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110544010
Pattern recognition receptors [BR:mun04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   110544010
SSDB
Motif
Pfam: NACHT NLRC4_HD2 NOD2_WH AAA_16 AAA_30
Other DBs
NCBI-GeneID: 110544010
NCBI-ProteinID: XP_021485838
LinkDB
Position
Unknown
AA seq 524 aa
NPKIYQAHLKKKLTQDWSRKFSIKVEDLFKEKLTQEDYDHFEDLLLSKTTGKKPQTVFLQ
GVAGIGKSLLLAKLMLAWSDGHVFQNKFSYIFYFCCDDVKQLKTASLAELISREWPSPSA
PIVEILSEPEKLLFIIDSLEGMKCDFTERESKLCDNWMEKQPVNILLSSLLRRKLLPESS
LLISGTPEAFEKMEGRLECTNVKVMSGFSENSIKMYFHSLFEDRNRAQEAYSVVRENEHL
FTLCEVPLICWMVATCLKKEIEKGREPVAICRRTTSLYTTHIFNLFIPRSARHPSKKSQA
QLQGLCSLAAEGMWTDTFVFSEEALRRNGIISSDISTLLDMRILLKSREPENCYIFLHPS
VQEICAAVFYLLKSHVDHPSQDVKCVKTLMFMFLKKVKVQWIYLGCFIFGLLHESEQEKL
VMFFGYQLSQDIKHQLNQCLETISDDRKLQEQIDSMKLFYCLFEMEDEAFLVQAMSCMEQ
INFVAKNYSDFMVVAYCLRHCSALKKLSFSTQNVLHEEHEQSYM
NT seq 1577 nt   +upstreamnt  +downstreamnt
gaaacccaaagatatatcaagctcatttgaagaaaaagctgacccaagattggtccagaa
agttcagtatcaaagttgaggatttgtttaaggagaaattgacccaggaagactatgatc
attttgaggaccttcttttatcaaagacaactggaaagaagccacagacggtgttcctgc
aaggagtggcaggaattggcaagtccctgttgttggcaaagttgatgctggcctggtcag
atggccatgtgtttcagaacaaattctcctacatcttctacttctgctgtgacgatgtga
agcagttgaagacagcaagcctggctgaactgatctccagagagtggcccagcccctcag
ctcccatagtggagatattatctgaacctgagaaactcttatttatcattgacagcttgg
aagggatgaaatgtgatttcaccgaacgggaatcgaagttgtgtgataattggatggaga
agcagccagtgaatatactgctgagcagtttgctcaggaggaagctactccctgaatcct
ctctcctcatctcaggtacaccagaggcttttgagaaaatggagggtaggcttgagtgca
caaatgtaaaagtaatgtcaggattcagtgagaacagtattaagatgtatttccacagct
tgttcgaggataggaacagagcccaggaagcctacagtgttgtgagagaaaatgagcatc
tgtttactctgtgtgaggtccctctgatctgctggatggtggctacttgtctgaagaaag
aaatagagaagggaagagagccagtcgccatctgccgacgtaccacctccctgtatacca
ctcacatcttcaatttgttcattccccgaagtgcccgtcatccaagtaagaaaagccaag
ctcagctgcaaggcttgtgctccctggctgcagagggtatgtggactgacacatttgtgt
tcagcgaggaggctctcaggagaaatgggatcattagttctgacatctccacactgctgg
acatgaggatacttctaaagagcagggaacctgaaaactgttacatattcctccacccat
ctgtccaggagatctgtgctgctgtcttttatctgctaaagagccacgtggaccacccta
gtcaggatgttaaatgtgtaaagacactcatgtttatgtttctaaagaaagtcaaagtac
agtggatttatttgggctgtttcatctttggccttttgcacgaatcagaacaagaaaagc
tagtgatgttttttggctaccagttgtctcaggatataaaacatcagttaaatcagtgcc
ttgaaaccataagtgatgatagaaagcttcaagaacaaatagacagcatgaagttatttt
actgtctgtttgagatggaggatgaggccttcttagtgcaagcaatgagctgtatggaac
agattaactttgtggctaaaaattattctgattttatggttgtcgcctactgcctaagac
attgttctgcactgaagaaactatcgttttcaacccaaaatgtcctacatgaagagcatg
aacaaagctatatgtga

DBGET integrated database retrieval system