KEGG   Meriones unguiculatus (Mongolian gerbil): 110544895
Entry
110544895         CDS       T05884                                 

Gene name
Evc2
Definition
(RefSeq) limbin isoform X1
  KO
K19608  ellis van creveld syndrome protein 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110544895 (Evc2)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    110544895 (Evc2)
SSDB
Motif
Pfam: EVC2_like
Other DBs
NCBI-GeneID: 110544895
NCBI-ProteinID: XP_021486362
LinkDB
Position
Unknown
AA seq 1215 aa
MGARGPPGARGRASWMLAGGVLAAALVLGAGPRAFPPVFSALGPGAPSRPGFAQPQPSSQ
YRDISREAQGPSENGVIFQKCSLVSGQSESQAMRVQLSVNNTRTPTSANLSDLLVLDEIA
GLAVKESPGNKTQDGIQAFRVKFLKVGECYSVSYMASLDPTALGTGKSLDLPALLMFQSP
SSQNRTQIKAPFTIAVEEKITVLPNHGLHAAAFIAAFLISLMLTLVTLFFLAQGWCIQGS
VLARCRARHPENKLEPSPFTSANGVSQDLSFNDQVVDILTSEDPGGMLQALEELEIATLN
QADADLEACRNQISKDIIALLMKNLTSSGHLSLQTERKMASAFKKQFLMLENEIQEEYER
KMLALTAECDLEMRKKTESQYQREMLAMEEAEEVLKRVSERSAAECSSLLRTLHGLEQEE
MQRSLALQQAEDFAQAHRQLAIFQRNELHSIFYTQIQSAVAKGELRPEVAKMLLQDYSKT
QESVEELMDFFQATKRYHLSKRFGHREYLVQSLQAMETRVQGLLSTAASQLTSLIHKHER
AGYLDEDQMEMLLERAQTETFSIKQKLDNDLKQEKKRLHQKLVTKRRRELLQKHKEQQKE
QVSLGEASSIAEDAIQYLRQWKSVMAEHTAALEELQERLDQAALDDLRALTVSLSEKATE
ELRRLQSTTMTQELLKRSAPWLFLQQILEEHSRESATRTAQLEAEERERGQELVQGVRQR
LQQDAPEACTDEQAELRHWEHSVFTKLCCAATSLSEEDLLRVRQEAQSCFTQLDRSLALP
RVRARVLQQQLQMAWREAEFRKLDQALAAPELQPKAKKLRSKGRGKADLLKKSLEDKIRL
FEERAPEDLADKVRGELLQERVQRLEAQEAHFAESLVALQFQKVARAAETISVYTALLSI
QDLLLGELSESETLTKSACMQILESHSPELQELERKLEDRLVQQEVAEQQQVLESWPQWA
ADGPGLSESGDMDPERQVSAILRQALSKGQNILEQHQQRVKEERQNSAVLEDSLESMEAD
TMANLCSQGLRLVSYLSRMTMVPGSTFLRLLSVVLPAASQPQLLALLDTVSEKHSDHTEN
ESSVEQAEQGKRRKHQGWWQALDSRLRADLVSQGLERMLWALRKKESLLKKIYVPVQERV
MFPGKGSWPHLSVEPIGELAAIPITGADTMDILNTGEKIFVFRSPKEPEISFRVPPKKKK
NFLNSKKASRTLGLD
NT seq 3648 nt   +upstreamnt  +downstreamnt
atgggggcgaggggtcccccgggagcccgcggacgagcctcgtggatgctggctgggggc
gtcctggccgcggcccttgtgctgggcgcgggtccccgcgcgttcccacccgtcttctct
gcactgggcccaggggcaccatcccggcccggctttgcccaaccgcagccaagctctcag
tacagagatatttcaagagaagcccaaggtccctctgagaatggagtgatatttcaaaaa
tgctcactggtgtctgggcagagtgagtcccaggccatgcgtgtgcagctgtctgtgaac
aacaccaggacacccacgtcagccaacctttcggacctgcttgtgcttgatgagatcgct
ggcctcgctgtgaaggagtctcctggaaataagacccaagacgggatccaggctttcaga
gtgaagtttctgaaagtgggagagtgctactctgtcagctacatggcttcactggacccc
acagctcttggaactggaaagagcctggaccttccagccctgctcatgtttcagagcccc
tcctcacagaacagaacgcagataaaagccccctttaccatcgcagtggaagaaaagata
acggttctgcctaaccatggtctccatgcagcagccttcatcgcagccttcctcatctcc
ctcatgctgaccttggtgaccctgttcttcctggcacagggatggtgtattcagggaagt
gtgctggccagatgccgggctcggcaccctgagaacaagctggagccctcgcccttcacc
tctgctaatggggtgagccaggatctttccttcaatgaccaagtggtggacatcctgact
tctgaggaccccgggggcatgcttcaagccctagaagagttggagatcgcaaccctgaat
caggcagatgcagacctggaggcttgtcgaaaccaaattagtaaggacatcatcgctctt
ctgatgaagaatctgaccagtagtggtcatctctctctacaaacagagaggaagatggcc
agtgctttcaaaaaacagtttctgatgctggaaaatgaaatacaagaggaatatgagcgg
aagatgttggcactgacggcagagtgtgacctagaaatgaggaagaaaacagaaagccag
tatcagagggagatgctggccatggaagaagcagaagaggtgttgaagcgagttagtgag
aggtctgctgcagagtgcagcagccttttgcggaccctccacgggctggagcaggaggaa
atgcagaggtccctcgccctgcaacaagcagaggattttgcccaagcgcacaggcagctg
gctatcttccagagaaatgaattgcatagcatcttctatacccagatacagagcgctgtt
gccaaaggggaactgaggcccgaggtggctaaaatgttgctgcaagactattctaaaaca
caggagagtgtggaggagctgatggacttcttccaggccaccaagcggtaccatctcagc
aagaggtttggccacagggagtacctggtccagagcctgcaggccatggagacccgtgtg
caagggctgctgagcaccgcagctagccagctgacaagcctcatccacaaacatgagagg
gctgggtacttggatgaagatcagatggaaatgctgttggagcgtgcacagacagaaacc
ttttctataaaacagaagctagacaatgacttaaagcaggaaaagaaaaggctccaccaa
aaattagtaactaagagacggcgagagcttctgcagaagcacaaggagcagcagaaggag
caggtatcccttggcgaggcctccagcatcgcagaggatgcaatccagtacctgcgccag
tggaaaagtgtgatggccgagcacacagctgccctggaggagctacaggagcgtctggac
caggctgccctggatgaccttcgggccctgaccgtgtcactgtctgagaaagccacggag
gagctgaggcgcctgcagagcacaaccatgacacaggagctgctgaagcgcagtgctccc
tggctcttcctgcagcagatcttggaggagcacagccgggagtctgccacccgcactgca
cagctcgaggcagaggagagagagcgtggccaggagctggtgcagggcgtgaggcagagg
ctacagcaggacgcaccagaggcctgcacggacgagcaggcagagctgaggcattgggag
cactcagtgttcacgaagctctgctgtgcagccacctcactgtctgaagaagacctgctc
agggtgaggcaggaagcccagagctgcttcacccagctggaccggagcttggccctcccc
agagtccgggcgcgagtgctgcagcagcagttgcagatggcctggagggaagcagagttc
cggaaactggaccaggccctggctgcacctgagctgcagcccaaggctaaaaagctacgt
tccaagggcagaggcaaggcggaccttctgaagaagagcctggaggataagatccgcctc
tttgaggaacgggcccctgaagacctggctgacaaggtgcgaggggaattgctccaggag
agggtacagaggctggaggcccaggaggcacactttgctgaatcacttgtggctctgcag
ttccagaaggtagcccgggctgctgagaccatctcagtctacaccgccctgcttagcatt
caagacctgctgctgggggagctgagtgagtccgagacactgaccaagtcagcctgtatg
cagatcctggagtcccacagcccggagctgcaggaactggagaggaagctggaggaccgg
ctggtgcagcaggaagtagctgagcagcagcaggtcctggagagctggccgcagtgggcg
gctgatgggcctgggctgagtgaatctggggatatggaccctgaaaggcaggtgtccgcc
atcctgaggcaggccctgagcaagggccagaacatactggaacagcatcagcagagggtg
aaagaggagcggcagaacagtgcagtgctggaagattctctggaaagcatggaggctgac
accatggccaacctatgcagtcagggactgaggctggtgtcgtacctctcaaggatgaca
atggtgccagggagcacgttcctccggctcctgagtgtggtgcttccagcagcttcacag
cctcagctactggccctgctggatacagtcagtgaaaagcactcagaccacacagagaat
gagagcagtgtggagcaggctgagcagggcaagaggaggaaacaccagggctggtggcaa
gctttggacagcaggctgagagcagatctggtgagtcaaggactggagaggatgctatgg
gccctccggaaaaaggagagcttattgaagaagatatatgttcctgtccaggagagggtg
atgttccctgggaaaggaagctggccacacctatctgtagagcccattggagaactggca
gccatccccatcacaggggcagacaccatggacatattaaacacaggagaaaagatcttt
gtattcagaagtccaaaggagcctgagatctctttccgtgttcctcccaagaagaaaaag
aattttctgaattccaagaaggccagcaggaccttgggcttagactga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110544913
Entry
110544913         CDS       T05884                                 

Gene name
Evc
Definition
(RefSeq) ellis-van Creveld syndrome protein isoform X1
  KO
K19605  ellis van creveld syndrome protein 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110544913 (Evc)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    110544913 (Evc)
SSDB
Other DBs
NCBI-GeneID: 110544913
NCBI-ProteinID: XP_021486370
LinkDB
Position
Unknown
AA seq 954 aa
MGSKGAFKRWNAEAEKDDTQRLLRSSEPSAQSLRDIGSRARRRQREMTTSRDENAPEECE
PSLSGNITAFALKARVVYPINQKFRPLADGSSHPSLHENLTQAAAILPHLPHQPAEASPV
SSLGSLSQAGKEDGSSSSSMPSAYSDDRILRYAFLRVGSFPEVLACESADIDLCVCSLHL
KDLLQVDTALRQEKHLMFIQILKACLMDFFPKKKPDDELYQKILSKQEHDLEELEKGLQA
RLVNTEMLGTGDPGYISLADVERKERELSEQLIDNMGAFWKQMDSIQPILMDQFKCSSSK
ARQFMMALTGRMIAAEGLLHDSQDLQALDALETAMGRAHMARLVEFLRTQIQEETKCRLA
AISRGLELLTVQGQLSGRQKEELLTQQHKAFWEEAESFGREFMQRGKDLVQTSLARQAEM
RAELTHAQEEKQRSFLADSQLTPDLGEFLKAFHEVLERQRLARSDQEEEEDIRITEAMAA
LCQELYCGTMETFQKFVDTLFLKTLPEVSGLPVAECESLRQQVQEQAARQLGQADRFRRQ
QWGLLCDLLEQDRRVWLEECALSMALQRQLREHHESTIHGVLSRFSGLSEESTQGILQGH
ELLLCSALRRLALRGTTITALAQMRLSGKKRLLQELREQLALEQGASPCLEEHQWQLLNA
LEARILEESARLEDEAQQTGLRLQQQLLAEAQEAGQLLQLHSERAIGQALLVHARNVASK
VRTRDKEDFKRTLVETVVESVYVTSTGVSRLVQAYYQGIGKLLQTHKKQLLQRLKTLQGE
RINAYKLWKKREFGDLPSGSQTADGSRGASQAVQQRMLSQQKKLRGQFTQHQQGRLNSQR
QKAQELDHLEAQLDNQLQEAEQTFISELATLARVPLTENKPFSNKRGLPEKPVRTKRKKP
PPQEREDLGLPNDDHPALADHTTGPLSSRRLGQQDSEAGNGENPRKMLQKRSNL
NT seq 2865 nt   +upstreamnt  +downstreamnt
atgggatcaaaaggagcgtttaagcgatggaatgcggaggcagagaaagatgacactcaa
cgtttgctcaggagttcagagccctctgcacagagcctgcgggatattggctcccgggcc
aggaggcgccagagagaaatgacaacttctagagatgagaatgctcctgaggagtgtgag
ccttccttgagtggcaacatcacagcgtttgcgctgaaagccagggttgtctaccccatc
aaccagaagttccggcctctggctgacggatcctcccacccttcgctacatgaaaacctg
acacaggcagccgccatcctgccccacctgccccatcagccagcagaggcctcaccagtc
agcagcctgggcagcctgagccaggctggcaaggaggatggtagctcctcctctagcatg
ccctcagcctacagtgatgacaggatcctccgatacgccttcctccgggtgggcagcttc
cctgaggttctggcctgtgagagtgcggatattgacctatgtgtctgcagccttcacctg
aaagacctgcttcaggtagacacagcgctaaggcaagagaagcacctgatgttcattcag
attctcaaagcatgcctcatggacttttttcctaaaaagaagcctgatgatgaattatac
cagaagattctttccaaacaagagcatgatttggaggaattagaaaagggacttcaggcc
agattggtgaacacggaaatgttgggcactggtgaccctggctacatttccctggcagat
gtggagaggaaggagagagagctctcggagcagctcatagacaatatgggagctttctgg
aagcagatggacagcatccagcccattctcatggatcagtttaaatgctccagctccaag
gcacgacagttcatgatggctctgacaggaagaatgattgctgcggaagggctgctgcat
gactctcaggacctgcaggccctggatgccctggagacagcaatgggtcgggctcacatg
gcaagattagtagagttcctgaggacccagatccaggaggagacgaagtgccggctggct
gccatctcccgtggcctggagctgctgactgtccagggtcagctgtctgggaggcagaag
gaggaacttctgacccaacagcacaaggccttctgggaggaggcagagagctttggcagg
gaattcatgcagcggggcaaagacctggtccagacatctctggctcgccaggcggagatg
agggcagagctcacacatgcccaggaagaaaaacagagaagtttcctggctgattcccag
ctgaccccagacctgggggagttcctcaaggcttttcatgaggtcctggagaggcagcgg
ctggcacggagtgaccaggaggaggaagaggacatcaggatcactgaggccatggctgca
ctctgccaggagctgtactgtggcaccatggaaactttccaaaagtttgtggacaccctg
tttctgaagactctcccagaagtgagcggcctccctgtggcagaatgtgagtccctgcgg
caacaggtccaggagcaggcagcgagacagctggggcaggcagaccgattccgcagacag
cagtggggactcctgtgtgacctgttggagcaggacaggcgagtgtggctagaggagtgt
gctttgtctatggcgctgcagaggcaactgcgggagcaccacgagagcaccatccacggg
gtcctgagccgattcagtggcctctccgaagagtccacacaaggcatccttcagggccac
gagctgctgctgtgctctgccctgcgcagactggccctccgaggcaccaccatcactgcc
ctggcacagatgaggctgtctgggaagaagaggctcctgcaggagctgcgtgagcagctg
gctctagagcagggcgcatccccgtgcctggaggagcatcagtggcagctacttaacgcc
ctggaggcgcggatcctggaggaatctgccaggctggaggatgaggctcagcagaccggc
ctgcggctccagcagcagctgctggcagaggcacaggaggcagggcagctgctacagctg
cactcagagagagccattgggcaggcgctactggtgcacgcccggaatgtggccagcaag
gtcaggacgagggacaaggaagacttcaagaggacgctggtggagacggtggtggagagt
gtgtacgtgaccagcaccggcgtcagccgcctcgtgcaggcgtattaccagggcatcggg
aagctcctgcagacccacaaaaaacagctgctacagcgcctcaagaccctgcagggtgag
agaatcaatgcttacaaactgtggaagaagcgagaattcggtgacctgccgtcggggagc
caaacagcagatggttcccgaggagcttcccaagcggtacagcagaggatgctgtcacag
cagaagaaactccggggccagttcacacagcaccaacagggccgcctgaactctcagagg
cagaaggcacaagagctcgaccacctggaagcccagcttgataatcagctacaggaagct
gagcagacctttatctcagagctagcgacactggcccgagtgccccttactgaaaacaag
ccattctccaacaagcgaggactgccagagaaaccagtaaggaccaaaaggaaaaagccc
ccacctcaagagagagaggacctgggactgcccaatgatgaccaccctgccttggcggac
cacaccacaggaccactcagcagcagaaggctgggccagcaggacagtgaagctggcaat
ggagaaaacccaaggaagatgctgcagaagagaagcaatctgtag

DBGET integrated database retrieval system