KEGG   Meriones unguiculatus (Mongolian gerbil): 110545060
Entry
110545060         CDS       T05884                                 

Gene name
Casp9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04115  p53 signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04370  VEGF signaling pathway
mun04919  Thyroid hormone signaling pathway
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05014  Amyotrophic lateral sclerosis
mun05016  Huntington disease
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05134  Legionellosis
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05210  Colorectal cancer
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05215  Prostate cancer
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110545060 (Casp9)
   04151 PI3K-Akt signaling pathway
    110545060 (Casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110545060 (Casp9)
   04215 Apoptosis - multiple species
    110545060 (Casp9)
   04115 p53 signaling pathway
    110545060 (Casp9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110545060 (Casp9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110545060 (Casp9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110545060 (Casp9)
   05212 Pancreatic cancer
    110545060 (Casp9)
   05215 Prostate cancer
    110545060 (Casp9)
   05213 Endometrial cancer
    110545060 (Casp9)
   05222 Small cell lung cancer
    110545060 (Casp9)
   05223 Non-small cell lung cancer
    110545060 (Casp9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110545060 (Casp9)
   05012 Parkinson disease
    110545060 (Casp9)
   05014 Amyotrophic lateral sclerosis
    110545060 (Casp9)
   05016 Huntington disease
    110545060 (Casp9)
   05020 Prion disease
    110545060 (Casp9)
   05022 Pathways of neurodegeneration - multiple diseases
    110545060 (Casp9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110545060 (Casp9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110545060 (Casp9)
   05152 Tuberculosis
    110545060 (Casp9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110545060 (Casp9)
   05161 Hepatitis B
    110545060 (Casp9)
   05160 Hepatitis C
    110545060 (Casp9)
   05164 Influenza A
    110545060 (Casp9)
   05162 Measles
    110545060 (Casp9)
   05168 Herpes simplex virus 1 infection
    110545060 (Casp9)
   05163 Human cytomegalovirus infection
    110545060 (Casp9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110545060 (Casp9)
   05169 Epstein-Barr virus infection
    110545060 (Casp9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110545060 (Casp9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110545060 (Casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110545060 (Casp9)
   01002 Peptidases and inhibitors [BR:mun01002]
    110545060 (Casp9)
Enzymes [BR:mun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     110545060 (Casp9)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110545060 (Casp9)
Peptidases and inhibitors [BR:mun01002]
 Cysteine peptidases
  Family C14: caspase family
   110545060 (Casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 110545060
NCBI-ProteinID: XP_021486584
LinkDB
Position
Unknown
AA seq 453 aa
MDEADRELLRRGRVRLVGELQVAELWDALLSRELFTRDMIEDIQRAGCGSRRDQARQLVT
DLETRGRQALPLFISCLEDTGQDALASFLRTSRQAAKQDPEPVKPLPHLEPVVLGPMGFK
PEEQKVGKLEPSQPAPGHLTPVVLGPKELWPARLRPEVLRPETPRPVNVGSGGAHDACAP
ETIREHADMAYVLDSDPCGHCLIINNVNFCPSSGLSTRTGSNLDCEKLQHRFRQLHFMVE
VMNDLTAKKMIAALMEMAHQDHHALDCFVVVILSHGCQASHLQFPGAVYGTDGYPVSIEK
IVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVPHTFSKGRAFDSDSEPDAVPYQEG
PMTFDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDSVLEQWARSEDLLS
LLLRVSNAVSEKGIYKQIPGCFNFLRKKLFFKT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggacgaggctgatcgggagctcctgcggcgaggccgggtacgcctggtgggcgagctg
caagtcgccgagctctgggacgctctgctgagtcgagagctcttcacgcgagacatgatc
gaggatattcagcgggcaggctgtgggtctcggcgggatcaggccaggcagctggtcaca
gatcttgagacccgagggaggcaggcccttcccctcttcatctcctgcttggaggacaca
ggccaagacgccctggcttcattcttacgcaccagtcggcaagcagccaagcaggatcca
gagcctgttaaacccctacctcacctggaacctgtggtcctgggaccaatgggattcaaa
ccagaggaacagaaagtagggaagctggagccatcacagcctgccccgggacacctcacg
ccagtggtgctggggcccaaagagctctggcctgctcggctcaggccagaggttctcaga
ccagaaacacctaggccagtgaacgttggctctggcggagctcatgatgcctgtgcgcca
gagaccatcagggaacatgcagatatggcgtatgtcctggattcggacccctgcggccat
tgcctcatcatcaacaatgtgaatttctgcccttcctcggggctcagcacacgcactggc
tccaacctggactgtgagaagcttcagcaccgcttccgccagctgcatttcatggtggag
gtgatgaatgacctgactgccaagaagatgattgcagctctgatggagatggcgcaccag
gaccaccatgccctggactgctttgtggtggtcatcctctctcatggctgccaggccagc
cacctccagttcccaggtgctgtctatggcacagatggataccctgtgtccattgagaaa
attgtgaacatcttcaatgggaccagctgccccagcctgggcggaaagccgaagttgttc
ttcatccaggcgtgcggtggcgagcagaaagaccatggctttgaggtgcctcacactttc
tctaaaggcagggccttcgacagtgactctgagccagatgctgtcccataccaggaaggc
ccaatgaccttcgaccagctggatgcagtgtcaagtttgcccactcccagtgacatcctt
gtgtcctattccaccttcccaggttttgtctcctggcgagacaagaagagtggctcctgg
tacattgagaccttggacagcgtcctggagcagtgggctcgctctgaagatctgctgtcc
ctccttctcagggtatccaatgctgtttctgagaaaggaatttataagcagattcctggc
tgttttaactttctccggaaaaaactcttttttaaaacttaa

DBGET integrated database retrieval system