KEGG   Meriones unguiculatus (Mongolian gerbil): 110545141
Entry
110545141         CDS       T05884                                 

Gene name
Gpr161
Definition
(RefSeq) G-protein coupled receptor 161
  KO
K08439  G protein-coupled receptor 161
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110545141 (Gpr161)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mun04030]
    110545141 (Gpr161)
G protein-coupled receptors [BR:mun04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    110545141 (Gpr161)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 110545141
NCBI-ProteinID: XP_021486722
LinkDB
Position
Unknown
AA seq 529 aa
MSLNSSADYRKELSNLTAPDGGEGGVVTEFIALIIITVFVCLGNLVIVVTLYKRSYLLTL
SNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGVI
AIDRYYAVLYPMVYPMKITGNRAVMALVYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVAA
WHREPGYTVFWQIWCALFPFLIMLVCYGFIFRVARVKARKVHCGTVVTVEEDAQRSGRKN
SSTSTSSSGSRRNAFQGVVYSANQCKALITILVVIGAFVVTWGPYMIVITSEALWGKNCV
SPTLETWATWLSFTSAICHPLIYGLWNKTVRKELLGMCFGDRYYREPFVQRQRTSRLFSI
SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSYSQDSGTDVMLLEDGASDDNPPSHC
TCPPKRRSSVTFEDEVEQIKEAAKNSLLHVKAEVHKSLDSYAASLAKAIEAEAKINLFGD
EALPGVLFTARTVPGASFGGRRGSRTLVNQRLLQLQSIEEGNVLAAEQR
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgagcctcaactcctccgccgactacagaaaggagctgagcaatctcactgccccggac
ggtggcgaagggggcgttgtcaccgagttcatagccctcatcatcatcactgtcttcgtc
tgcctgggcaacctagtcatcgtagtcaccctctacaagaggtcctacctcctcaccctc
agcaacaagttcgtcttcagcctgaccctgtccaacttcctgctgtccgtgctggtgctg
ccgttcgtggtgactagctccatccggagggaatggatctttggcgtggtctggtgcaac
ttctccgccctcctctacctgctcatcagctcggccagcatgcttacccttggggtcatt
gccatcgaccgctattacgctgtcctgtatccgatggtgtaccccatgaagatcacaggg
aaccgcgccgtgatggcccttgtctacatctggcttcactccctcattggctgcctgccc
cccctgttcggctggtcgtcggtggagtttgatgagttcaagtggatgtgtgtggctgcg
tggcaccgggaacctggctacaccgtcttctggcagatctggtgtgccctgtttcccttt
ctcatcatgctcgtgtgctacgggttcatcttccgtgtggccagggtcaaggcccgcaag
gtccactgcggcacggtggtcaccgtggaggaggacgcccagaggagtgggaggaagaac
tccagcacctccacttcctcttcaggcagcaggaggaatgcctttcaaggcgtggtctac
tcagctaaccagtgcaaagccctcatcaccatcctggtggtcatcggtgccttcgtggtc
acctggggcccctacatgattgtcatcacctcagaggcgctctggggaaagaactgtgtc
tccccaaccttggagacgtgggccacatggctgtcctttaccagtgccatctgccaccct
ctgatctacggcctctggaacaaaactgttcgcaaggagctcctgggcatgtgctttggg
gaccgctattaccgggaaccatttgtgcagcggcagaggacctccaggctcttcagcatc
tccaacaggatcacagacttgggcctgtccccgcacctcacggcgctcatggcaggcgga
cagcccctgggacacagcagcagcaccggggacactggtttcagctactctcaggattca
gggacggacgtgatgctgctggaagatggcgcttctgacgacaaccctccctcgcactgc
acttgcccacccaagagaaggagctctgtcacatttgaagatgaagtggaacagatcaaa
gaggctgccaagaactctcttcttcatgtgaaagccgaagtacacaaatccttggacagt
tatgcagccagcttggctaaagccattgaggctgaagccaaaatcaacttatttggggac
gaggctttgccaggggtcttgttcacagcacggaccgtcccgggggctagctttgggggc
cgtcgaggcagcaggactcttgtgaatcagaggctgctgcagctacagagcatcgaagaa
ggcaatgtcttagctgcagaacagagatga

DBGET integrated database retrieval system