KEGG   Meriones unguiculatus (Mongolian gerbil): 110545164
Entry
110545164         CDS       T05884                                 

Definition
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04115  p53 signaling pathway
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04932  Non-alcoholic fatty liver disease
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05014  Amyotrophic lateral sclerosis
mun05016  Huntington disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05134  Legionellosis
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05210  Colorectal cancer
mun05222  Small cell lung cancer
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110545164
   04215 Apoptosis - multiple species
    110545164
   04115 p53 signaling pathway
    110545164
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110545164
  09162 Cancer: specific types
   05210 Colorectal cancer
    110545164
   05222 Small cell lung cancer
    110545164
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110545164
   05012 Parkinson disease
    110545164
   05014 Amyotrophic lateral sclerosis
    110545164
   05016 Huntington disease
    110545164
   05017 Spinocerebellar ataxia
    110545164
   05020 Prion disease
    110545164
   05022 Pathways of neurodegeneration - multiple diseases
    110545164
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110545164
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110545164
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110545164
   05134 Legionellosis
    110545164
   05152 Tuberculosis
    110545164
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110545164
   05161 Hepatitis B
    110545164
   05160 Hepatitis C
    110545164
   05164 Influenza A
    110545164
   05162 Measles
    110545164
   05168 Herpes simplex virus 1 infection
    110545164
   05163 Human cytomegalovirus infection
    110545164
   05167 Kaposi sarcoma-associated herpesvirus infection
    110545164
   05169 Epstein-Barr virus infection
    110545164
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110545164
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110545164
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 110545164
NCBI-ProteinID: XP_021486753
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccacact
gtggaaaagggaggcaagcataagactggacccaatctccatggtctttttgggcggaag
acaggtcaggccgctggattctcctacacagatgccaacaagaacaaaggtatcacctgg
ggagaggataccctgatggagtatttggagaatcccaaaaagtacatccctggaacaaaa
atgatcttcgctggaattaagaagaagggagaaagggcagacctaatagcttatcttaaa
aaggctaccaatgagtaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110555979
Entry
110555979         CDS       T05884                                 

Definition
(RefSeq) cytochrome c, testis-specific
  KO
K08738  cytochrome c
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04115  p53 signaling pathway
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04932  Non-alcoholic fatty liver disease
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05014  Amyotrophic lateral sclerosis
mun05016  Huntington disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05134  Legionellosis
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05210  Colorectal cancer
mun05222  Small cell lung cancer
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110555979
   04215 Apoptosis - multiple species
    110555979
   04115 p53 signaling pathway
    110555979
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110555979
  09162 Cancer: specific types
   05210 Colorectal cancer
    110555979
   05222 Small cell lung cancer
    110555979
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110555979
   05012 Parkinson disease
    110555979
   05014 Amyotrophic lateral sclerosis
    110555979
   05016 Huntington disease
    110555979
   05017 Spinocerebellar ataxia
    110555979
   05020 Prion disease
    110555979
   05022 Pathways of neurodegeneration - multiple diseases
    110555979
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110555979
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110555979
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110555979
   05134 Legionellosis
    110555979
   05152 Tuberculosis
    110555979
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110555979
   05161 Hepatitis B
    110555979
   05160 Hepatitis C
    110555979
   05164 Influenza A
    110555979
   05162 Measles
    110555979
   05168 Herpes simplex virus 1 infection
    110555979
   05163 Human cytomegalovirus infection
    110555979
   05167 Kaposi sarcoma-associated herpesvirus infection
    110555979
   05169 Epstein-Barr virus infection
    110555979
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110555979
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110555979
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 110555979
NCBI-ProteinID: XP_021505163
LinkDB
Position
Unknown
AA seq 105 aa
MGDAEVGKKIFVQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGYSYTDANKNKGVIW
SEATLMEYLENPKKYIPGTKMIFAGIKKRSEREDLIQYLKEATSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatgctgaagtaggcaagaagatctttgttcagaaatgtgctcagtgccacaca
gtggaaaaaggtggaaagcacaagacaggcccaaatctctggggcctttttggacgaaag
acaggacaagcaccaggatattcttacactgatgcaaacaagaacaaaggtgttatctgg
tcagaagcaactttgatggagtatttggagaacccaaagaaatacattcctggcactaaa
atgatctttgctggtatcaaaaagaggagtgagagagaagatcttattcagtatttgaaa
gaggcaacatcctcatga

DBGET integrated database retrieval system