KEGG   Meriones unguiculatus (Mongolian gerbil): 110545371Help
Entry
110545371         CDS       T05884                                 

Gene name
Sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00020  Citrate cycle (TCA cycle)
mun00190  Oxidative phosphorylation
mun01100  Metabolic pathways
mun01200  Carbon metabolism
mun04714  Thermogenesis
mun04932  Non-alcoholic fatty liver disease (NAFLD)
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05016  Huntington disease
Module
mun_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mun_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mun_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110545371 (Sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110545371 (Sdha)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    110545371 (Sdha)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110545371 (Sdha)
   05012 Parkinson disease
    110545371 (Sdha)
   05016 Huntington disease
    110545371 (Sdha)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    110545371 (Sdha)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110545371 (Sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 110545371
NCBI-ProteinID: XP_021487104
LinkDB All DBs
Position
Unknown
AA seq 664 aa AA seqDB search
MAGVGAVSRLIRGRRLALAGSWPAASHTQTRGFHFTVGENKKASAKVSDAISTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTIAAQGGINAALGNMEEDNWK
WHFYDTVKGSDWLGDQDAIHYMTEQAPSSVIELENYGMPFSRTEEGRIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECCGVIALCIE
DGSIHRIKAKNTVIATGGYGRAYFSCTSAHTTTGDGLAMVTRAGLPCQDLEFVQFHPTGI
YGVGCLITEGCRGEGGILINGQGERFMERYAPVAKDLASRDVVSRSMTMEIREGRGCGPE
KDHVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLKHVNGRDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAETCRPGDK
IPPIKANAGEESVMNLDKLRFADGSIRTAELRLRMQKLMHNNAAVFRVGSVLQEGCEKIS
QLYGDLKHLKTFDRGIIWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKER
IDEYDYSKPIQGQQKRPFEEHWRKHTLSYVDVESGKVTLNYRPVIDKTLNEADCATIPPA
VRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggccggggttggcgcagtttcgaggcttattcgcgggcggcggttggcgctagctggg
tcgtggccagcggcatcccacacacagacccgtggctttcacttcactgttggtgagaac
aagaaggcatctgctaaagtttcagatgcgatttctactcaatacccagttgtggatcat
gaatttgatgctgtggtagtaggtgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatactgcttgccttacaaagctctttcctacccgatcacatacg
attgcagcacaggggggcatcaatgctgcactggggaacatggaagaggacaactggaaa
tggcatttctatgacaccgtgaaaggctctgactggctgggggatcaggatgccatccat
tacatgacagagcaagctccttcctccgtgattgagctagaaaattatggtatgccattt
agcagaactgaagaagggaggatttatcagcgtgcatttggtggacagagcctcaagttt
gggaaaggcgggcaggctcatcggtgctgttgtgtggccgatcggacaggccactcactc
ttacacaccttgtatggaaggtctctgcgatatgacaccagctattttgtggagtatttt
gccttggatcttctgatggaaaatggggagtgctgtggtgttattgcactctgcatagaa
gatggatccatacaccgaataaaagcaaagaatactgttattgctactgggggctatggg
cgagcctatttcagctgcacatctgcccataccaccacaggggatggcttagccatggtc
accagggctggcttgccttgccaggacttagagtttgttcagttccaccccacaggtata
tatggtgttggctgtctcatcacagaagggtgtcgtggagagggcggtattctcatcaac
ggtcaaggtgaaaggttcatggaaagatacgcccctgttgccaaggacctggcctccagg
gatgttgtatcccgatccatgactatggagattcgtgaaggaagaggctgtggccctgag
aaggatcatgtctacctgcagttgcaccatctgccccctgagcagctggccatgcgtctg
cctggaatctcagagacggccatgatcttcgctggtgtggatgtcaccaaggagcccatc
cctgtcctccccactgtccattacaacatgggtggcattcccactaactacaaggggcag
gtgctgaagcacgtgaatggccgggatcagattgtgcctggcctgtacgcctgtggggag
gctgcctgcgcctcagtgcatggtgccaatcgacttggagcaaactctctattagatctt
gttgtcttcggccgagcctgtgccttgagcattgcagaaacttgcaggccaggagataaa
attcctccaattaaggcaaatgctggagaagagtcggtcatgaatcttgacaagttgcga
tttgctgatggaagcataagaacagcagaactgcgcctcaggatgcagaagttgatgcat
aataatgctgcagtgttccgtgtgggaagcgtactgcaagaaggctgtgagaaaatcagc
cagctgtatggagacctgaagcacctgaagacatttgacaggggaataatctggaataca
gacctggtggagaccctggagctacagaacctgatgctatgtgcactgcagaccatatat
ggtgcagaggcacggaaggagtcacggggtgctcatgccagggaagattataaagagcgg
attgatgagtatgactactccaagcccatccagggacagcagaagaggccctttgaggaa
cactggaggaagcacaccctctcatacgtggacgtcgagtctgggaaggttactttgaat
tatagacctgttattgacaagaccttgaatgaggctgactgtgccaccatccctcctgct
gtccgttcctactga

DBGET integrated database retrieval system