KEGG   Meriones unguiculatus (Mongolian gerbil): 110545385
Entry
110545385         CDS       T05884                                 

Gene name
E2f2
Definition
(RefSeq) transcription factor E2F2 isoform X1
  KO
K09389  transcription factor E2F2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04110  Cell cycle
mun04218  Cellular senescence
mun04934  Cushing syndrome
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05206  MicroRNAs in cancer
mun05212  Pancreatic cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110545385 (E2f2)
   04218 Cellular senescence
    110545385 (E2f2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110545385 (E2f2)
   05206 MicroRNAs in cancer
    110545385 (E2f2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110545385 (E2f2)
   05225 Hepatocellular carcinoma
    110545385 (E2f2)
   05226 Gastric cancer
    110545385 (E2f2)
   05214 Glioma
    110545385 (E2f2)
   05220 Chronic myeloid leukemia
    110545385 (E2f2)
   05218 Melanoma
    110545385 (E2f2)
   05219 Bladder cancer
    110545385 (E2f2)
   05215 Prostate cancer
    110545385 (E2f2)
   05224 Breast cancer
    110545385 (E2f2)
   05222 Small cell lung cancer
    110545385 (E2f2)
   05223 Non-small cell lung cancer
    110545385 (E2f2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110545385 (E2f2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110545385 (E2f2)
   05161 Hepatitis B
    110545385 (E2f2)
   05160 Hepatitis C
    110545385 (E2f2)
   05163 Human cytomegalovirus infection
    110545385 (E2f2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110545385 (E2f2)
   05169 Epstein-Barr virus infection
    110545385 (E2f2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110545385 (E2f2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110545385 (E2f2)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110545385 (E2f2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP FerA CRISPR_Cas2
Other DBs
NCBI-GeneID: 110545385
NCBI-ProteinID: XP_021487122
LinkDB
Position
Unknown
AA seq 439 aa
MLRAPRTLAPAAAQPTKSLPALNPTELWPPGLGSPQLCPATTTATAYYTSLYTQTVPSSA
ALGTCLDATPHGPEGQIVRCVPAGRLPAKRKLDLEGIGRPTVPEFRTPKGKCIRVDGLPS
PKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLE
GIQLIRKKSKNNIQWVGRGIFEDPTRPAKQQQLGQELKELMNAEQTLDQLIQSCSLSFKH
LTEDNANKKLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRAEENLQIYLKSTQGP
IEVYLCPEEVQEPDSPAREALPSTSGLSPIADGAEPSCSTDPGIPETPSSVLMPQPVPPP
PPPAPSLVPLEATDNMLELTHPLLQQTEDQFLSPILTASSPLISFSPPLDHDEYLWGMDE
GEGISDLFDSYDLGDLLIN
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgctgcgcgcgccgcggaccctggctccggccgccgctcaacccacaaagagcttgccc
gccttgaaccccaccgagctgtggcctccggggctcggcagcccccagctctgcccggcc
accaccaccgccaccgcctactacacttcgctttacacgcagaccgtgccttcctctgcc
gcgttgggcacttgcctcgatgccactccccacggacccgagggccaaattgtgcgatgt
gtgcccgcgggccggctgccggccaaaaggaagctggacctggaaggcattgggaggccc
accgtccctgagttccggactcccaaggggaagtgcatccgagtggatggtttgccaagc
cccaaaacccccaagtctcccggggagaagacacgctatgacacgtcactggggctgctc
accaagaagttcatttacctcctgagcgagtctgaggatggagtcctggacctcaactgg
gcagccgaggtgctggatgtgcagaagcggcgcatttatgacatcaccaacgtgctggag
ggcatccagctcatccgcaagaagtccaaaaacaacatccagtgggtaggcaggggaata
tttgaagaccccacccgacctgcgaagcagcagcagctggggcaggagctgaaggagctg
atgaacgcggagcagaccctggaccagctcattcagagttgctcgctgagcttcaagcac
ctgactgaggataacgccaacaagaaactggcctatgtgacctaccaggatatccgtgct
gtgggcaacttcaaggagcagacagtgatagcagttaaagcccctcctcagacaagactg
gaagtgccggacagggcagaggagaacctgcagatttatctgaagagcacccaagggccc
attgaagtctacctgtgcccagaggaagtgcaggagccagacagtcctgccagggaggct
ctcccctccacctctggcctcagccccatcgctgacggcgctgagcccagctgcagcacc
gaccctgggatcccagagacaccatcttcagtactgatgccccagccggtcccgccaccg
ccaccgccagcaccgtccctcgtccccttggaagccaccgacaacatgctggagctgacg
cacccccttctgcaacagactgaggaccagttcctgtccccgatcctgacagccagctcc
cctctgatcagcttctccccgcccctggaccacgacgagtacttgtggggcatggatgag
ggtgagggcatcagtgacctcttcgactcctatgaccttggggacctgttgattaactga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110554547
Entry
110554547         CDS       T05884                                 

Gene name
E2f1
Definition
(RefSeq) transcription factor E2F1 isoform X1
  KO
K17454  transcription factor E2F1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04110  Cell cycle
mun04137  Mitophagy - animal
mun04218  Cellular senescence
mun04934  Cushing syndrome
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05206  MicroRNAs in cancer
mun05212  Pancreatic cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110554547 (E2f1)
  09143 Cell growth and death
   04110 Cell cycle
    110554547 (E2f1)
   04218 Cellular senescence
    110554547 (E2f1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110554547 (E2f1)
   05206 MicroRNAs in cancer
    110554547 (E2f1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110554547 (E2f1)
   05225 Hepatocellular carcinoma
    110554547 (E2f1)
   05226 Gastric cancer
    110554547 (E2f1)
   05214 Glioma
    110554547 (E2f1)
   05220 Chronic myeloid leukemia
    110554547 (E2f1)
   05218 Melanoma
    110554547 (E2f1)
   05219 Bladder cancer
    110554547 (E2f1)
   05215 Prostate cancer
    110554547 (E2f1)
   05224 Breast cancer
    110554547 (E2f1)
   05222 Small cell lung cancer
    110554547 (E2f1)
   05223 Non-small cell lung cancer
    110554547 (E2f1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110554547 (E2f1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110554547 (E2f1)
   05161 Hepatitis B
    110554547 (E2f1)
   05160 Hepatitis C
    110554547 (E2f1)
   05163 Human cytomegalovirus infection
    110554547 (E2f1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110554547 (E2f1)
   05169 Epstein-Barr virus infection
    110554547 (E2f1)
   05165 Human papillomavirus infection
    110554547 (E2f1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110554547 (E2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110554547 (E2f1)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110554547 (E2f1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP INPP5B_PH TP1 Baculo_PEP_C
Other DBs
NCBI-GeneID: 110554547
NCBI-ProteinID: XP_021502892
LinkDB
Position
Unknown
AA seq 432 aa
MAVAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQVPAGPAAPPAGPRDPD
VLLFATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFRGRGRHPGKGVKSP
GEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAK
KSKNHIQWLGSHTMVGISKRLESLTQDLQQLQESEQQLDHLMHICTTQLQLLSEDSDSQR
LAYVTCQDLRSIADPAEQMVIVIKAPPETQLQAVGSAETFQISLKSKQGPIDVFLCPEES
TAGLSPGRTPCQETSGEDRTADIGTAGPPPSPPSTSPALDPSQSLLGLEQEPVLSRMGNL
RAPTEDDRLSPLVAADSLLEHVREDFSGLLPGEFISLSPPHEAVDYHFGLEEGEGIRDLF
DCDFGDLTPLDF
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggccgtagcccccgcgggcggccagcacgcgccggcgctggaggccctgctcggggcg
ggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctccaccgcgcccgatgtc
ggcgccccgcaggtccccgccggcccggccgcgccgcccgccggcccccgcgatcctgac
gtgctgctcttcgccacgccgcaggcgccccgacccgcgcctagtgcaccgcgcccggcc
ctcggccgcccgccggtaaaacggaggctggatctggaaaccgaccatcagtatctggct
ggtagcagcgggccattccggggcagaggccgccacccagggaaaggtgtgaaatctccg
ggggagaagtcacgctatgagacatcactaaatctgaccaccaaacgcttcttggagctg
ctgagccgctcagctgacggcgtggttgacctgaactgggccgctgaggtgctgaaggtg
cagaagcggcgcatctatgacatcaccaatgtcctcgagggcatccagctcattgccaag
aagtccaagaatcatatccagtggctaggcagccacaccatggtgggaatcagtaagcgg
cttgaaagcctgacccaggacctacagcaactgcaggagagcgagcagcagctggaccac
ctgatgcacatctgcaccacccagctgcaactgctctccgaggactcagacagccagcgc
ctggcctatgtgacctgccaggaccttcgaagcatcgcagaccctgcagaacagatggtc
atagtgatcaaggcccctcccgagacccaactacaagctgtgggttctgcggagacattt
cagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgccctgaggagagt
acagcagggctcagccccgggaggaccccatgccaggagacatctggggaggacaggacc
gctgacattggcactgcagggcctccaccatcacctccctcgacatccccagccttggat
cccagccagtccctgctaggcctggagcaagaaccagtattgtcacggatgggcaatctg
agggcccccacagaagatgaccgtttgtcacccctggtggctgctgactcactcctagaa
catgtccgagaagacttctctgggctcctccctggggagttcatcagcctttcccccccc
cacgaggccgttgactaccactttggtctcgaggagggtgagggcatcagagatctcttt
gactgtgactttggggacctgacacctctggatttctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110561800
Entry
110561800         CDS       T05884                                 

Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04110  Cell cycle
mun04218  Cellular senescence
mun04934  Cushing syndrome
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05206  MicroRNAs in cancer
mun05212  Pancreatic cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110561800
   04218 Cellular senescence
    110561800
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110561800
   05206 MicroRNAs in cancer
    110561800
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110561800
   05225 Hepatocellular carcinoma
    110561800
   05226 Gastric cancer
    110561800
   05214 Glioma
    110561800
   05220 Chronic myeloid leukemia
    110561800
   05218 Melanoma
    110561800
   05219 Bladder cancer
    110561800
   05215 Prostate cancer
    110561800
   05224 Breast cancer
    110561800
   05222 Small cell lung cancer
    110561800
   05223 Non-small cell lung cancer
    110561800
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110561800
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110561800
   05161 Hepatitis B
    110561800
   05160 Hepatitis C
    110561800
   05163 Human cytomegalovirus infection
    110561800
   05167 Kaposi sarcoma-associated herpesvirus infection
    110561800
   05169 Epstein-Barr virus infection
    110561800
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110561800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110561800
Transcription factors [BR:mun03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110561800
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 110561800
NCBI-ProteinID: XP_021513994
LinkDB
Position
Unknown
AA seq 340 aa
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHRPMKTNN
QDHNGNIPKPTSKDLASNNSGHSECSVSTANLSPLASPANLLQQTEDQIPSNLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgaaggctggagctgggcgagagtggccatcagtac
ctctcagatggtctaaagacccccaagggcaaaggaagagctgcactacggagtcctgat
agtccaaaaactccaaaatctccctcagaaaaaacgcggtatgatacgtcactcggtctg
ctcaccaagaagttcattcagctcctgagccagtcgcctgatggggtcctggatctgaac
aaggcagcagaggtgctcaaagtgcagaagaggaggatttacgacatcaccaacgtgctg
gaaggcatccacctcatcaagaagaagtcgaagaacaacgtccagtggatgggctgcagt
ctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtccaaagaagtgaccgag
ctcagtcaggaagagaagaaattagatgagctgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgattcaatagagagcctacaaatacatttggcaagtacccaagggccc
attgaggtttacttgtgtccagaagagacggaaacacacagacccatgaaaacaaataac
caagaccacaatgggaatatccctaagcccacttccaaagacttggcttctaacaactca
ggacatagcgaatgctcggtttctacagcaaacctctctcctctggcctccccagccaac
cttttacagcagactgaggaccaaattccttccaacctcgaaggaccttttgtgaacttg
ctgcctcccctactccaagaggactacctgctgagcctgggggaggaggagggcatcagt
gatctcttcgatgcgtatgatttggaaaagctgcccctcgtggaggacttcatgtgtagt
tga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110561801
Entry
110561801         CDS       T05884                                 

Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04110  Cell cycle
mun04218  Cellular senescence
mun04934  Cushing syndrome
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05206  MicroRNAs in cancer
mun05212  Pancreatic cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110561801
   04218 Cellular senescence
    110561801
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110561801
   05206 MicroRNAs in cancer
    110561801
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110561801
   05225 Hepatocellular carcinoma
    110561801
   05226 Gastric cancer
    110561801
   05214 Glioma
    110561801
   05220 Chronic myeloid leukemia
    110561801
   05218 Melanoma
    110561801
   05219 Bladder cancer
    110561801
   05215 Prostate cancer
    110561801
   05224 Breast cancer
    110561801
   05222 Small cell lung cancer
    110561801
   05223 Non-small cell lung cancer
    110561801
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110561801
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110561801
   05161 Hepatitis B
    110561801
   05160 Hepatitis C
    110561801
   05163 Human cytomegalovirus infection
    110561801
   05167 Kaposi sarcoma-associated herpesvirus infection
    110561801
   05169 Epstein-Barr virus infection
    110561801
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110561801
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110561801
Transcription factors [BR:mun03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110561801
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 110561801
NCBI-ProteinID: XP_021513996
LinkDB
Position
Unknown
AA seq 340 aa
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHRPMKTNN
QDHNGNIPKPTSKDLASNNSGHSECSVSTANLSPLASPANLLQQTEDQIPSNLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgaaggctggagctgggcgagagtggccatcagtac
ctctcagatggtctaaagacccccaagggcaaaggaagagctgcactacggagtcctgat
agtccaaaaactccaaaatctccctcagaaaaaacgcggtatgatacgtcactcggtctg
ctcaccaagaagttcattcagctcctgagccagtcgcctgatggggtcctggatctgaac
aaggcagcagaggtgctcaaagtgcagaagaggaggatttacgacatcaccaacgtgctg
gaaggcatccacctcatcaagaagaagtcgaagaacaacgtccagtggatgggctgcagt
ctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtccaaagaagtgaccgag
ctcagtcaggaagagaagaaattagatgagctgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgattcaatagagagcctacaaatacatttggcaagtacccaagggccc
attgaggtttacttgtgtccagaagagacggaaacacacagacccatgaaaacaaataac
caagaccacaatgggaatatccctaagcccacttccaaagacttggcttctaacaactca
ggacatagcgaatgctcggtttctacagcaaacctctctcctctggcctccccagccaac
cttttacagcagactgaggaccaaattccttccaacctcgaaggaccttttgtgaacttg
ctgcctcccctactccaagaggactacctgctgagcctgggggaggaggagggcatcagt
gatctcttcgatgcgtatgatttggaaaagctgcccctcgtggaggacttcatgtgtagt
tga

DBGET integrated database retrieval system