KEGG   Meriones unguiculatus (Mongolian gerbil): 110545551
Entry
110545551         CDS       T05884                                 

Gene name
Tradd
Definition
(RefSeq) tumor necrosis factor receptor type 1-associated DEATH domain protein
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04064  NF-kappa B signaling pathway
mun04071  Sphingolipid signaling pathway
mun04210  Apoptosis
mun04217  Necroptosis
mun04622  RIG-I-like receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04668  TNF signaling pathway
mun04920  Adipocytokine signaling pathway
mun05132  Salmonella infection
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110545551 (Tradd)
   04064 NF-kappa B signaling pathway
    110545551 (Tradd)
   04668 TNF signaling pathway
    110545551 (Tradd)
   04071 Sphingolipid signaling pathway
    110545551 (Tradd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110545551 (Tradd)
   04217 Necroptosis
    110545551 (Tradd)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    110545551 (Tradd)
   04657 IL-17 signaling pathway
    110545551 (Tradd)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110545551 (Tradd)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110545551 (Tradd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110545551 (Tradd)
   05152 Tuberculosis
    110545551 (Tradd)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110545551 (Tradd)
   05160 Hepatitis C
    110545551 (Tradd)
   05164 Influenza A
    110545551 (Tradd)
   05162 Measles
    110545551 (Tradd)
   05168 Herpes simplex virus 1 infection
    110545551 (Tradd)
   05163 Human cytomegalovirus infection
    110545551 (Tradd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110545551 (Tradd)
   05169 Epstein-Barr virus infection
    110545551 (Tradd)
   05165 Human papillomavirus infection
    110545551 (Tradd)
SSDB
Motif
Pfam: TRADD_N Death SAM_Exu Luteo_PO
Other DBs
NCBI-GeneID: 110545551
NCBI-ProteinID: XP_021487414
LinkDB
Position
Unknown
AA seq 312 aa
MAAGQNGHEEWVGSAYLFLESSLDKVVLSEAYADPKKKVALYKALQTALSESESADSPDV
LEILKIHCSDPQLVVQLRFCGRPLCGRFLKAYREGALRTALQRCIASALAQEALRLQLEL
RAGAEQLDTWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDGSGQGGAPQVAPA
ASKSLVASLIEEKSLPEARQTFLFHGQLVVNRPLNLQDQQTFARSVGLKWRRVGRSLQRS
CRALRDPALDSLAYEYERDGLYEQAFQLLRRFKQAEGRRATLQLLVEALEENELTSLAEE
LVGQAEPDGGPA
NT seq 939 nt   +upstreamnt  +downstreamnt
atggccgctgggcaaaatgggcacgaggagtgggtgggcagtgcatacctgtttttggag
tcttcgctggacaaggtggtcctgtctgaagcctacgcagatcccaagaagaaggtggca
ctatacaaggctcttcagactgcattgtcagagagtgagagtgcggacagccctgacgtg
ctggagatactcaagatccactgcagcgacccgcagctcgtcgtgcaactgcgtttctgc
gggcgcccgctgtgcggccgcttcctcaaagcctaccgcgagggggcgctgcgcaccgcg
ctgcagaggtgcatcgcctcagcgctcgcccaggaagcgctgcggctgcagctggagtta
cgcgctggcgcggagcagctggacacttggctgaccgatgaagagcgctgtttgaattac
atcttagcccagaagcccgacaggctccgggatgaggaactcgcggagctggaggatgag
ctctgcaaactgacctgtgacggcagtggccagggtggagccccacaggtagctccagcc
gcttcgaagtccctggttgcctctcttatcgaggagaagtcactgccggaggcccgccag
acttttctgtttcatgggcaactcgtagtgaaccggccactgaatctgcaagaccagcag
acgttcgcgcgctcggtgggcctcaagtggcgcagggtggggcgctcgctgcagcgcagc
tgtcgagcgctgagggatcctgccctcgactcgctggcctacgagtacgagcgcgacggg
ctgtacgagcaggccttccagctgctgcgccgcttcaagcaagccgagggccgccgggcc
acgctgcagctcctggtggaggcgctggaggagaacgagctcaccagtctagcggaggag
ctggtgggccaggcggagcccgatggcggcccggcctag

DBGET integrated database retrieval system