KEGG   Meriones unguiculatus (Mongolian gerbil): 110545829
Entry
110545829         CDS       T05884                                 

Gene name
Calr
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04141  Protein processing in endoplasmic reticulum
mun04145  Phagosome
mun04612  Antigen processing and presentation
mun05142  Chagas disease
mun05163  Human cytomegalovirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110545829 (Calr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110545829 (Calr)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110545829 (Calr)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110545829 (Calr)
   05170 Human immunodeficiency virus 1 infection
    110545829 (Calr)
   05168 Herpes simplex virus 1 infection
    110545829 (Calr)
   05163 Human cytomegalovirus infection
    110545829 (Calr)
   05169 Epstein-Barr virus infection
    110545829 (Calr)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110545829 (Calr)
Chaperones and folding catalysts [BR:mun03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   110545829 (Calr)
Lectins [BR:mun04091]
 Calnexin / calreticulin
  110545829 (Calr)
SSDB
Motif
Pfam: Calreticulin MDM10
Other DBs
NCBI-GeneID: 110545829
NCBI-ProteinID: XP_021487879
LinkDB
Position
Unknown
AA seq 416 aa
MLLSVPLLLGLLGLAAAEPAVYFKEQFLDGDDWTNRWVESKHKSDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGSLDQK
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPNAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDANIYAYDNFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDEDDRDEDEEDEDEKEEDEEDAAGLAKDEL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgctcctctcggtgccgctcctgctcggcctcctcggcctggccgctgcagagcctgcc
gtctatttcaaagagcaattcttggacggagatgactggaccaaccgctgggtcgaatcc
aaacataagtccgattttggcaaatttgtcctcagttctggcaaattctacggggaccag
gagaaggataaagggctgcagacaagccaagatgcccgattttacgcactgtctgccaga
ttcgaaccctttagcaacaagggccagacactggtggtacagttcacggtgaagcatgag
cagaatatcgactgtgggggtggctacgtgaagctgtttccgggtagtttggaccagaag
gatatgcatggagactcggagtacaacatcatgtttggtccggacatctgcggtcctggc
accaagaaggttcatgtcatctttaactacaagggcaagaatgtgctgatcaacaaggat
atccggtgcaaggatgatgagttcacacacctgtacacactgattgtgcggccagacaac
acctatgaggtgaaaattgacaacagtcaggtggaatcaggctccctggaggacgattgg
gactttctgccaccaaagaagataaaggatcctaatgctgccaagccagaagactgggac
gaacgagccaagattgatgaccctacagattctaagcctgaggactgggacaagcctgag
cacatccctgaccctgatgctaagaagcctgaggactgggatgaagagatggatggagag
tgggaaccaccagtgattcagaatccggaatacaagggcgagtggaagccacgtcagatt
gacaacccagattacaagggtacctggatacacccagaaattgacaaccctgaatactcc
cccgatgccaacatctatgcctatgataattttgctgtactaggcctagatctctggcag
gttaagtctggcacaatctttgacaacttcctcatcaccaatgatgaggcctatgcagag
gagtttggcaatgagacatggggtgtcaccaaggctgcagagaagcagatgaaggacaag
caggatgaagagcagaggcttaaggaagaagaagaagacaagaagcgtaaagaggaggaa
gaggctgaagacaaagaagatgaggatgacagagatgaagatgaagaagatgaagatgag
aaggaggaagatgaggaggatgccgctggtctggccaaggacgagctgtag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110563573
Entry
110563573         CDS       T05884                                 

Definition
(RefSeq) calreticulin-like
  KO
K08057  calreticulin
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04141  Protein processing in endoplasmic reticulum
mun04145  Phagosome
mun04612  Antigen processing and presentation
mun05142  Chagas disease
mun05163  Human cytomegalovirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110563573
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110563573
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110563573
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110563573
   05170 Human immunodeficiency virus 1 infection
    110563573
   05168 Herpes simplex virus 1 infection
    110563573
   05163 Human cytomegalovirus infection
    110563573
   05169 Epstein-Barr virus infection
    110563573
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110563573
Chaperones and folding catalysts [BR:mun03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   110563573
Lectins [BR:mun04091]
 Calnexin / calreticulin
  110563573
SSDB
Motif
Pfam: Calreticulin
Other DBs
NCBI-GeneID: 110563573
NCBI-ProteinID: XP_021516386
LinkDB
Position
Unknown
AA seq 439 aa
MRIPWLPPVLLLLTACTLSTQRKRLVYFREEFKDGDGWTKRWVQSKHQSDYGKFQLSSGK
FYQDKERDKGLQTTEDAKFYALSTRFKPFSNENETLVVQFSVKHEQGIDCGGGYVKLFPA
SLDQDDMHAESQYYIMFGPDICGFGNNRLQVILYHQGKYHENNKTLKCRINKDTHLYTLI
IRPNATYEVKIDNEKVTSGTLEEDWDFLPPKKIKDPYARKPRKWDERLQIEDPDDKKPED
WEDSEFIPDPEAKKPDDWDEAMDGVWEGPLIRNAKYKGEWKPRIIDNPNYQGEWIHPEID
NPKYRPDPTICHYHNISVLGLDLWQVKSGSIFDNFLLTNDEEFAEEVGNMTWGLRKDIEQ
QWRELYEEMEKKKEAEEAKKKREKERAREEDVWGLDEEEEEEEDGEESDEADEKPKQKYS
AGRTALGKEEAHFDQKDEL
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcggatcccatggctgccgcctgtgctgctgctgctgaccgcctgcaccttgagcacc
cagaggaagcgcctcgtctacttccgggaggagttcaaagatggggatggatggacaaag
cgatgggtacaatctaaacatcagtcagattacggaaaattccagcttagttcgggaaaa
ttttatcaagacaaagaaagagataaaggtctccagaccacggaagatgccaagttctat
gccctttccaccaggtttaagccattcagcaatgagaatgagaccttggtggttcagttt
tcagtaaagcatgagcaaggcatcgattgcggtgggggctacgtgaagctctttcctgcc
tcactcgaccaggatgacatgcacgctgagtcccagtattacatcatgttcggcccagac
atctgtggctttggcaacaacagactacaggtcatcctctatcaccaagggaaataccat
gagaacaacaagaccctcaagtgcaggattaataaggacactcacctgtacaccctgatc
atccgcccgaacgccacgtacgaggtgaaaatcgacaacgagaaggtgacgagcggaacg
ctggaagaagactgggacttcctgcctcccaagaagattaaagacccctacgccaggaaa
ccaaggaaatgggatgagcggctacagatagaggatcctgacgataaaaaacctgaggac
tgggaggactctgagttcataccagacccggaagccaagaagccggatgactgggatgag
gcgatggacggggtgtgggaagggccgctgatacggaacgccaagtacaagggagaatgg
aaacctcggatcatcgacaatcccaattaccagggggagtggattcacccagagatagac
aaccccaaatacaggcctgaccccaccatttgtcactatcacaacatcagcgtccttggc
ctggatctttggcaggtgaaatcgggcagcatctttgacaatttccttctaacgaatgat
gaggagtttgctgaagaggttggaaatatgacctgggggttaagaaaggatatagaacag
cagtggagagagctgtatgaagaaatggagaaaaagaaggaggcggaagaggccaagaag
aagagggagaaggagcgagccagggaagaggatgtgtgggggctggatgaggaggaggag
gaggaggaggatggagaggagtccgacgaagcagatgaaaagcccaagcagaagtacagc
gccgggaggacagctctgggcaaagaggaagcccactttgatcagaaggacgaactgtaa

DBGET integrated database retrieval system