KEGG   Meriones unguiculatus (Mongolian gerbil): 110545842Help
Entry
110545842         CDS       T05884                                 

Gene name
Prkaca
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04010  MAPK signaling pathway
mun04014  Ras signaling pathway
mun04020  Calcium signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04114  Oocyte meiosis
mun04140  Autophagy - animal
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04261  Adrenergic signaling in cardiomyocytes
mun04270  Vascular smooth muscle contraction
mun04310  Wnt signaling pathway
mun04340  Hedgehog signaling pathway
mun04371  Apelin signaling pathway
mun04530  Tight junction
mun04540  Gap junction
mun04611  Platelet activation
mun04713  Circadian entrainment
mun04714  Thermogenesis
mun04720  Long-term potentiation
mun04723  Retrograde endocannabinoid signaling
mun04724  Glutamatergic synapse
mun04725  Cholinergic synapse
mun04726  Serotonergic synapse
mun04727  GABAergic synapse
mun04728  Dopaminergic synapse
mun04740  Olfactory transduction
mun04742  Taste transduction
mun04750  Inflammatory mediator regulation of TRP channels
mun04910  Insulin signaling pathway
mun04911  Insulin secretion
mun04912  GnRH signaling pathway
mun04913  Ovarian steroidogenesis
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04916  Melanogenesis
mun04918  Thyroid hormone synthesis
mun04919  Thyroid hormone signaling pathway
mun04921  Oxytocin signaling pathway
mun04922  Glucagon signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04924  Renin secretion
mun04925  Aldosterone synthesis and secretion
mun04926  Relaxin signaling pathway
mun04927  Cortisol synthesis and secretion
mun04928  Parathyroid hormone synthesis, secretion and action
mun04934  Cushing syndrome
mun04935  Growth hormone synthesis, secretion and action
mun04961  Endocrine and other factor-regulated calcium reabsorption
mun04962  Vasopressin-regulated water reabsorption
mun04970  Salivary secretion
mun04971  Gastric acid secretion
mun04976  Bile secretion
mun05012  Parkinson disease
mun05020  Prion diseases
mun05030  Cocaine addiction
mun05031  Amphetamine addiction
mun05032  Morphine addiction
mun05034  Alcoholism
mun05146  Amoebiasis
mun05163  Human cytomegalovirus infection
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110545842 (Prkaca)
   04010 MAPK signaling pathway
    110545842 (Prkaca)
   04310 Wnt signaling pathway
    110545842 (Prkaca)
   04340 Hedgehog signaling pathway
    110545842 (Prkaca)
   04371 Apelin signaling pathway
    110545842 (Prkaca)
   04020 Calcium signaling pathway
    110545842 (Prkaca)
   04024 cAMP signaling pathway
    110545842 (Prkaca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110545842 (Prkaca)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110545842 (Prkaca)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110545842 (Prkaca)
   04540 Gap junction
    110545842 (Prkaca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110545842 (Prkaca)
   04062 Chemokine signaling pathway
    110545842 (Prkaca)
  09152 Endocrine system
   04911 Insulin secretion
    110545842 (Prkaca)
   04910 Insulin signaling pathway
    110545842 (Prkaca)
   04922 Glucagon signaling pathway
    110545842 (Prkaca)
   04923 Regulation of lipolysis in adipocytes
    110545842 (Prkaca)
   04912 GnRH signaling pathway
    110545842 (Prkaca)
   04913 Ovarian steroidogenesis
    110545842 (Prkaca)
   04915 Estrogen signaling pathway
    110545842 (Prkaca)
   04914 Progesterone-mediated oocyte maturation
    110545842 (Prkaca)
   04921 Oxytocin signaling pathway
    110545842 (Prkaca)
   04926 Relaxin signaling pathway
    110545842 (Prkaca)
   04935 Growth hormone synthesis, secretion and action
    110545842 (Prkaca)
   04918 Thyroid hormone synthesis
    110545842 (Prkaca)
   04919 Thyroid hormone signaling pathway
    110545842 (Prkaca)
   04928 Parathyroid hormone synthesis, secretion and action
    110545842 (Prkaca)
   04916 Melanogenesis
    110545842 (Prkaca)
   04924 Renin secretion
    110545842 (Prkaca)
   04925 Aldosterone synthesis and secretion
    110545842 (Prkaca)
   04927 Cortisol synthesis and secretion
    110545842 (Prkaca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110545842 (Prkaca)
   04270 Vascular smooth muscle contraction
    110545842 (Prkaca)
  09154 Digestive system
   04970 Salivary secretion
    110545842 (Prkaca)
   04971 Gastric acid secretion
    110545842 (Prkaca)
   04976 Bile secretion
    110545842 (Prkaca)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110545842 (Prkaca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    110545842 (Prkaca)
  09156 Nervous system
   04724 Glutamatergic synapse
    110545842 (Prkaca)
   04727 GABAergic synapse
    110545842 (Prkaca)
   04725 Cholinergic synapse
    110545842 (Prkaca)
   04728 Dopaminergic synapse
    110545842 (Prkaca)
   04726 Serotonergic synapse
    110545842 (Prkaca)
   04720 Long-term potentiation
    110545842 (Prkaca)
   04723 Retrograde endocannabinoid signaling
    110545842 (Prkaca)
  09157 Sensory system
   04740 Olfactory transduction
    110545842 (Prkaca)
   04742 Taste transduction
    110545842 (Prkaca)
   04750 Inflammatory mediator regulation of TRP channels
    110545842 (Prkaca)
  09149 Aging
   04211 Longevity regulating pathway
    110545842 (Prkaca)
   04213 Longevity regulating pathway - multiple species
    110545842 (Prkaca)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110545842 (Prkaca)
   04714 Thermogenesis
    110545842 (Prkaca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110545842 (Prkaca)
   05205 Proteoglycans in cancer
    110545842 (Prkaca)
   05203 Viral carcinogenesis
    110545842 (Prkaca)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110545842 (Prkaca)
   05020 Prion diseases
    110545842 (Prkaca)
  09165 Substance dependence
   05030 Cocaine addiction
    110545842 (Prkaca)
   05031 Amphetamine addiction
    110545842 (Prkaca)
   05032 Morphine addiction
    110545842 (Prkaca)
   05034 Alcoholism
    110545842 (Prkaca)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    110545842 (Prkaca)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110545842 (Prkaca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110545842 (Prkaca)
   05163 Human cytomegalovirus infection
    110545842 (Prkaca)
   05165 Human papillomavirus infection
    110545842 (Prkaca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110545842 (Prkaca)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110545842 (Prkaca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110545842 (Prkaca)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mun03019]
    110545842 (Prkaca)
   03036 Chromosome and associated proteins [BR:mun03036]
    110545842 (Prkaca)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     110545842 (Prkaca)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: AGC group
  PKA family
   110545842 (Prkaca)
Messenger RNA biogenesis [BR:mun03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     110545842 (Prkaca)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110545842 (Prkaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110545842
NCBI-ProteinID: XP_021487916
LinkDB All DBs
Position
Unknown
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPSQNTAQLDQFDRLKTLGTGSFGRVML
VKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSITEKCGKEFTEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagagttctta
gccaaagccaaggaagattttctgaaaaaatgggagaacccttctcagaatacagcccag
ttggatcagtttgatagactcaagacccttggtactggctcctttgggcgtgtgatgctc
gtgaagcacaaggagagcgggaaccactatgccatgaagatcttggacaaacagaaggtg
gtaaagctgaagcagatcgagcacactctgaatgagaagcgcatcctgcaggctgtcaac
ttcccgttcctggtcaaacttgaattctccttcaaggacaactcaaacttatacatggtc
atggagtatgtgcctggtggagagatgttctctcacctacggcggatcggaaggttcagt
gagccccatgcccgtttctacgcggcgcagatcgtcctgacctttgagtatctgcactcc
ctggacctcatctaccgggacctcaagcccgagaaccttctcatcgaccagcagggctat
attcaggtgacagacttcggttttgccaagcgtgtgaaaggccgtacttggaccttgtgt
gggacccctgaatacttggcccccgagattatcctgagcaaaggctacaacaaggctgtg
gactggtgggctctcggggtcctcatctacgagatggctgctggttacccgcccttcttc
gctgaccagcctatccagatctacgagaaaatcgtctctgggaaggtgcggttcccatcc
cacttcagttctgacttgaaggacctgctacggaaccttctacaggtggatcttaccaag
cgctttggaaacctcaagaacggggtcaatgacatcaagaaccacaagtggtttgccaca
actgactggattgccatctatcagagaaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgacgactatgaggaggaagagatccgggtctccatc
actgagaagtgtggcaaggagtttactgagttttag

DBGET integrated database retrieval system