KEGG   Meriones unguiculatus (Mongolian gerbil): 110545938
Entry
110545938         CDS       T05884                                 

Gene name
Mgrn1
Definition
(RefSeq) E3 ubiquitin-protein ligase MGRN1 isoform X1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04120  Ubiquitin mediated proteolysis
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110545938 (Mgrn1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110545938 (Mgrn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110545938 (Mgrn1)
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110545938 (Mgrn1)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    110545938 (Mgrn1)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-C3HC4_2 zf-RING_5 zf-RING_11
Other DBs
NCBI-GeneID: 110545938
NCBI-ProteinID: XP_021488072
LinkDB
Position
Unknown
AA seq 579 aa
MGSILSRRIAGVEDIDIQANSAYRYPPKSAGNYFASHFFMGGEKFDTPHPEGYLFGENMD
LNFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGEKPRVLYS
LEFTFDADARVAITIYCQAVEEFLNGMAVYSCKNPSLQSETVHYKRGVSQQFSLPSFKID
FSEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVAGHAHVLLAAFEKHVDGSFSVKPLKQ
KQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSSECVVCLSDLRDTLILPCRHLCLC
TSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPISFSPVLAQSVDHDEHSCPFK
KSKSHPASLASKKPKRETSSDSVPPGYEPISLLEALNGLRAVSPAVPSAPLYEEITYSGI
SDGLSQASCPLAGLDRIIESGLQKGKPQSKSPDSTLRSPSSPIHEEDEEKLSEDSDTPLP
PSGVELALRESSSPESFGTEEVDEPVIKQGSRVPSIDDVLQDGSPQHHGCSQPVPPADIY
LPGWSTSMETPHSLGTTSAPWPLLSGSSPEPGATELTPL
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgggctccatcctgagtcgccgcatcgcgggcgtggaggacatcgacattcaggccaac
tcggcctatcgctatcccccgaagtccgcaggaaactactttgcttcacactttttcatg
ggaggagagaaatttgacaccccccatcctgaaggctacctctttggagagaacatggat
ctgaacttcctgggcagtcgtccagtccagtttccctatgtcacccctgccccccatgag
ccagtgaagacactgaggagcctggtaaacatccgcaaagactccctccggcttgtgagg
tacaaagacgatgctgacagccccacagaggatggtgagaagccccgtgtgctctacagt
ctggaattcacctttgatgccgatgcccgagttgctatcaccatttattgccaggcggtg
gaggagttcttaaacggcatggcagtgtacagctgtaagaacccttctctgcagtctgag
accgtccactacaagagaggcgttagccagcagttctccctgccttctttcaagattgac
ttctccgagtggaaggatgatgagctgaactttgacttggaccgaggtgtgtttccagta
gtcatccaggcagtggtggatgaaggagatgtcgtagaagtggctggccatgctcatgta
ctcttggctgcctttgagaagcatgtggatggcagcttctccgtgaagccattaaagcag
aaacaaattgtggaccgggtcagctacctgctacaggagatctacggcatcgagaacaag
aacaaccaggaaaccaagccttccgatgacgagaacagtgacaacagcagtgagtgtgtg
gtgtgcctgtcagacctgcgagacacgctgatcttgccctgccgccacctgtgcctctgc
acttcctgtgctgacacgctgcggtaccaagccaacaactgccccatctgccggctgcca
ttccgagctctcctgcagattcgggctgtgcggaagaagccaggggccctgtctcccatc
tccttcagccctgtcttggcccaaagtgtggaccatgatgagcactcttgtccctttaaa
aaatcaaagtcgcaccctgcctccctggccagcaagaaacctaaaagggaaacaagttct
gacagtgtcccacctggctatgagcccatctccttgcttgaggcactcaatggtctacgg
gctgtctccccggctgtcccatcagcccccctctatgaagaaatcacctactcaggcatc
tcagacggtctttcccaggccagctgtcctctcgctggactcgatcgaatcatagaaagt
ggcctacagaagggcaagccacaaagcaagtctccagacagcaccctgcggtctccatca
tcccccatccatgaggaggatgaggagaaactctcggaggactctgacactcctctccca
ccaagcggtgtggagctggcgcttcgggaaagcagctcccctgagagtttcggaacagaa
gaggtagatgagcctgtcataaagcaagggagccgagtaccttctattgatgatgtcctg
caggatggcagtccacagcaccatggttgcagccagccagtccctcctgctgacatctac
ctaccaggatggtccacctccatggagacgccacacagccttggcaccaccagcgccccc
tggcctctgctgagtggctctagtcctgagcctggagctacagagctgaccccactctga

DBGET integrated database retrieval system