KEGG   Meriones unguiculatus (Mongolian gerbil): 110546065
Entry
110546065         CDS       T05884                                 

Gene name
Bid
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04071  Sphingolipid signaling pathway
mun04115  p53 signaling pathway
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04650  Natural killer cell mediated cytotoxicity
mun04932  Non-alcoholic fatty liver disease
mun05010  Alzheimer disease
mun05014  Amyotrophic lateral sclerosis
mun05022  Pathways of neurodegeneration - multiple diseases
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    110546065 (Bid)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110546065 (Bid)
   04215 Apoptosis - multiple species
    110546065 (Bid)
   04217 Necroptosis
    110546065 (Bid)
   04115 p53 signaling pathway
    110546065 (Bid)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110546065 (Bid)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110546065 (Bid)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110546065 (Bid)
   05014 Amyotrophic lateral sclerosis
    110546065 (Bid)
   05022 Pathways of neurodegeneration - multiple diseases
    110546065 (Bid)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110546065 (Bid)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110546065 (Bid)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110546065 (Bid)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110546065 (Bid)
   05161 Hepatitis B
    110546065 (Bid)
   05160 Hepatitis C
    110546065 (Bid)
   05164 Influenza A
    110546065 (Bid)
   05162 Measles
    110546065 (Bid)
   05168 Herpes simplex virus 1 infection
    110546065 (Bid)
   05163 Human cytomegalovirus infection
    110546065 (Bid)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110546065 (Bid)
   05169 Epstein-Barr virus infection
    110546065 (Bid)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110546065 (Bid)
SSDB
Motif
Pfam: BID MOR2-PAG1_C Bcl-2
Other DBs
NCBI-GeneID: 110546065
NCBI-ProteinID: XP_021488318
LinkDB
Position
Unknown
AA seq 196 aa
MDSEVSNGSGLEAEHITNLLVFGFLQSSGHNFHQELEKLGHELPIPVYPEADLEDELQTD
GNRPSRAFYHGRIEPDSESQEELIQNLARHLAQVGDEMDQRIRPTLVRQLASQFMTGDLS
EEDRRNYLAQALDEVKTAYPKDMESDKAMLIMTMLLAKKVASHMPSLLRDVFRTTVNFIN
QNLFTYVRNLVRNEMD
NT seq 591 nt   +upstreamnt  +downstreamnt
atggactctgaggtcagcaacggctcaggcctggaggctgagcacatcacaaacctactg
gtgttcggctttctccaaagctctggccataatttccaccaagagctggagaaactgggt
cacgaactgcccataccagtttacccagaagcagaccttgaggacgagctgcagacagat
ggcaaccggcctagccgcgccttctaccatggaagaatagaaccagattctgaaagtcag
gaagaactcatccagaaccttgccagacatctcgcccaagtaggcgatgagatggaccag
cgcatccggcccacgctggtgagacagctggcctcgcagttcatgaccggcgacctgtcg
gaggaagacagaaggaactacctggcccaagccctcgatgaggtgaagacggcctaccct
aaagacatggagagcgacaaggccatgctgataatgaccatgctgctggccaaaaaagtg
gccagtcacatgccgtccttgctccgtgatgtctttcgcacgacagtgaactttattaac
cagaacctgttcacctatgtgaggaacttggttagaaatgagatggactga

DBGET integrated database retrieval system