KEGG   Meriones unguiculatus (Mongolian gerbil): 110546189
Entry
110546189         CDS       T05884                                 

Gene name
Lamc1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05020  Prion disease
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110546189 (Lamc1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110546189 (Lamc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110546189 (Lamc1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110546189 (Lamc1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110546189 (Lamc1)
  09164 Neurodegenerative disease
   05020 Prion disease
    110546189 (Lamc1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110546189 (Lamc1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110546189 (Lamc1)
   05145 Toxoplasmosis
    110546189 (Lamc1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 110546189
NCBI-ProteinID: XP_021488536
LinkDB
Position
Unknown
AA seq 1607 aa
MTGGGRAAPALRSRGRLWPLLVVLAAAAGCVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQLHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQD
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESANECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCNPSGSTDECNVETGRCVCKDNVEGFSCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFHIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDSYFPRYFIAPAKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RNAGYLDDVTLQSARPGPGVSATWVESCTCPVGYGGQFCETCLSGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTLGTASDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSSGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAASPADKCKACACNPYGTVQQQSSCNPVT
GQCECLPHVSGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDETVTDQAFEDRLKEAEREV
TDLLREAQGVKDIDQNLMDRLQRVNSSLHSQINRLQNIRNSIEETGVLAEQARTRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARRLAERHKQEADDIVRVAK
TANETSTEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
RAVEIYASVAQLSPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKRGRNTLQEANDILSNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNATS
TKADAERTFSEVTDLDNEVNGMLRQLEEAENELKRKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLTDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKASDLDRKVSDLE
NEARKQEAAILDYNRDIEEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
NT seq 4824 nt   +upstreamnt  +downstreamnt
atgacgggcggcgggcgggccgcgccggccctacggtccagggggcggctgtggcctctg
ctggtcgtgctggcggccgcggcgggctgtgtccgggcggccatggacgagtgcgcggac
gagggcggccggccgcagcgctgcatgccggagttcgtgaatgccgccttcaacgtgacc
gtggtggccaccaacacgtgcgggacgccgcccgaggagtactgcgtgcagaccggggtg
accggggtcaccaagtcctgtcacctgtgcgacgccggccagctccacctgcagcacggg
gctgccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccagacc
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctggggaaggcc
tttgacatcacctatgtgcgtctcaagttccacaccagccggccagagagtttcgccatt
tataagcgcacccgggaagacgggccctggattccttaccagtactacagtggctcctgt
gagaacacgtactccaaggccaaccgaggcttcatcaggacaggaggggacgagcagcag
gccttgtgtacggatgaattcagtgacatttctcccctcactgggggcaacgtggccttt
tcaaccctggaaggaaggccgagtgcctacaactttgacaacagccctgtgctgcaggat
tgggtaactgctactgacatcagagtgacactcaatcgcctaaacacctttggagatgaa
gtgtttaacgaccccaaagttctcaagtcctattattatgcaatctcagattttgctgtg
ggcggcaggtgtaaatgtaatggacatgctagtgagtgtgtaaagaatgaatttgacaag
ctcgtgtgcaattgcaaacataacacatatggagttgactgtgaaaagtgtctgcctttc
ttcaatgaccggccatggaggagggccactgccgaaagcgccaacgaatgcctaccctgt
gactgcaatggccgatcccaagagtgctactttgaccctgaactttaccgttccactgga
catggtggccactgtaccaactgccgcgataacacagatggtgccaagtgtgagaggtgc
cgggagaacttcttccgtcttgggaacactgaagcctgctctccatgccactgcagtccc
gttggttctctcagcacacagtgtgacagttacggcagatgcagctgtaagccaggagtg
atgggtgacaagtgtgaccgctgccagcccggattccattcccttactgaggcagggtgc
aggccatgctcctgtaatccctctggcagcacagatgaatgtaatgttgaaacaggaaga
tgtgtttgcaaagacaacgttgaaggcttcagctgtgagagatgcaaacctggctttttt
aatctggagtcatctaatcccaagggttgcacaccctgcttctgctttgggcattcttct
gtgtgcacaaatgctgttggctacagtgtttatgacatctcctccaccttccacattgat
gaggatgggtggcgtgtggagcagagagatggctcggaggcatctctcgagtggtcctca
gataggcaggacattgccgtgatctcggatagttacttccccaggtacttcatcgccccc
gcgaagttcctgggcaaccaggtcctaagttatggccagaacctctccttctccttccga
gtggacagacgggacactcgcctctccgcagaagatctggtgctcgagggagctggcttg
agagtgtcggtgcccttgatcgctcagggcaactcctaccctagtgagaccaccgtgaag
tacatcttcaggctccatgaagcaaccgattacccttggaggcccgctctctcgcccttt
gagtttcagaagctccttaacaacttgacctcaatcaagatccgtggcacatacagtgag
aggaatgctggctatttggatgacgtcaccttgcagagtgctcgtcccgggcccggagtc
tctgcaacttgggtagagtcctgcacctgtccagtggggtacggagggcaattctgtgag
acgtgcctctcaggctacagaagagaaactccaagtcttggaccatacagtccgtgtgtg
ctctgtacctgcaatggacacagtgagacctgtgaccccgagacaggtgtctgtaactgc
agagacaatacagctggcccccactgtgagaaatgtagtgacgggtactatggagactca
accctgggcaccgcctctgactgccaaccctgtccctgtcctggcggctcaagttgtgcc
attgtcccgaagacaaaggaggtggtgtgcacccactgtccaacgggcactgccggcaag
agatgtgaactctgtgatgacggctactttggagaccctctgggcagcagtgggcccgtg
agactgtgccgcccgtgtcagtgcaacgacaacatagaccccaacgcggtcggtaactgc
aaccgcctgactggagagtgcctgaagtgcatctataacacggctggcttctactgcgac
cggtgcaaagaaggcttttttggaaatcccctggctgccagtccagcagacaagtgcaaa
gcctgcgcctgcaatccctatgggacagtacagcagcagagcagctgtaaccctgtgacg
gggcagtgtgagtgtctgcctcacgtgtccggccgggactgtggtgcctgcgaccctggc
ttctacaacctgcagagcgggcaaggctgcgagaggtgtgactgccatgctttgggctcc
accaatgggcagtgcgacatccgtactgggcagtgtgagtgccagcctggcatcaccggt
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgtgactgtcatcatgaaggctccctttcactccagtgtaaagatgatggccgttgtgaa
tgcagggagggctttgtgggaaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcttggcccggctgccaggagtgtccagcttgttaccgcctggtaaaggataaggtt
gctgagcaccgagtgaagctccaggagttagagagcctcatagcaaaccttggcactggg
gatgagacggtgacagaccaagccttcgaggacagactgaaggaggcagagagggaggtt
acagacctcctccgtgaggctcagggtgtcaaagacatagatcaaaacttgatggatcgc
cttcagagagtgaacagcagtctgcatagccaaatcaaccgattgcagaatatccggaat
tccatcgaagagactggggtcctggctgagcaagcacggacccgagtggagagcacggag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgctgccaatgtg
tcaatcacccagccagagtctacaggtgaaccaaacaacatgaccctcttggcagaagaa
gcccgaaggcttgcagagcgccataagcaggaagctgacgacattgttcgcgtggcaaag
acagccaatgagacttccactgaggcatataatctgcttttgaggaccctggccggagaa
aatcaaactgcactggagattgaagagcttaataggaagtatgaacaagcaaagaacatc
tctcaggatctggagaagcaggctgccagagtccacgaggaagccaagcgagcaggtgac
agagccgtagagatctatgccagtgtggcccagctcagccctgtggactctgaggcgctg
gagaatgaagcaaataaaatcaagaaagaagctgccgatctggaccgtctgattgaccag
aagctaaaggactacgaggaccttagggaagacatgagggggaaggaacatgaagtaaag
aaccttctcgagaagggaaaagccgaacagcagaccgccgaccaactcctagcccgggct
gacgctgccaaggctcttgctgaagaagctgctaaaaggggacggaacaccttacaagaa
gccaatgacattctcagcaacctgaaagattttgacagacgcgtgaatgataacaagaca
gcagcagaggaagctctgcggagaattcccgccatcaaccggaccatcgctgaagccaat
gagaagacgagggaggcacagcttgcgctgggcaatgcggcagcggacgccacggaggcc
aagaacaaagcgcacgaggcggagaggatcgccagtgccgtgcagaagaacgccaccagc
accaaggcggatgccgagagaaccttctcggaagttacagatctggataatgaggtgaac
ggtatgctgaggcaactagaggaggctgagaatgagctgaagaggaaacaagatgatgct
gaccaggacatgatgatggcggggatggcttcacaggctgctcaggaagctgaactcaat
gccagaaaagccaaaaactctgtcagcagcctcctcagccaactgaccgaccttctcgag
cagctgggacagctggacacagtggacctgaacaagctaaatgagatcgaaggcaccctg
aacaaagccaaagatgagatgaaggccagtgatctggacaggaaggtgtctgacctggag
aatgaagcccggaagcaggaggcagccatcctggactataaccgagacatagaagaaatc
ataaaggacattcacaacctggaggacatcaagaagaccctaccgaccggctgcttcaac
accccgtccattgagaagccctag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110546194
Entry
110546194         CDS       T05884                                 

Gene name
Lamc2
Definition
(RefSeq) laminin subunit gamma-2
  KO
K06246  laminin, gamma 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110546194 (Lamc2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110546194 (Lamc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110546194 (Lamc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110546194 (Lamc2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110546194 (Lamc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110546194 (Lamc2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110546194 (Lamc2)
   05145 Toxoplasmosis
    110546194 (Lamc2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 110546194
NCBI-ProteinID: XP_021488551
LinkDB
Position
Unknown
AA seq 1189 aa
MPALWLSCCLALLLPAAQATSRREVCDCNGKSRQCVFDQELHRQTGSGFRCLNCNDNTAG
VHCERCREGFYRQRDRDRCLPCNCHSKGSLSAGCDNSGQCRCKPGVTGHRCDRCQPGFHT
LTDAGCTRDQRQLESKCDCDPAGIAGPCDSGRCVCKAAVTGARCDRCRPGYYHLDRANPE
GCTQCFCYGHSASCHSSADFSVHKITSTFYQDADGWKAVQRNGAPAKLHWSPRHQDVFSS
ARRSDPVFFVAPGKFLGNQQVSYGQSLSFDYRVDRGGRHPSAYDVILEGAGLQIRAPLMP
LGKTLPCGITKTYTFRLNEHPSSQWSPQLSYFEYRRLLRNLTALLIRATYGEYSTGYIDN
VTLISARPVSGAPAPWVEHCVCPAGYKGQFCQDCASGYKRDSARLGPFGSCIPCNCQGGG
ACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCN
NCPPGVTGARCELCADGYFGDPFGERGPVRPCQRCQCNNNVDPSASGNCDQLTGRCLKCI
YNTAGLHCDQCKAGYFGDPLAPNPADKCRACSCNPMGSEPGECRSDGSCVCKPGFGGPNC
EPAALTSCPACYNQVKTQMDQFTQQLQSLEALVSKAQGDGGTVPSAELEGRMQQLEQALR
DILREAQVSDGAKRALSLQLAKARSQENSYRNRLDDLKMAVERVQALGSQYQNRVQDTSR
LISQMRLGLAESEASLQNTNIHSSEHYVGPNGFKSLAQEATRLADSHVESANTMKQLARE
TEDYSKQALSLAREALSGGGGSGILDSSVVQGLMGKLEKTKSLAQQLSRESTQADFEADR
SYQHSLRLLDSASQLQGLSDLSFQVEAKRIRQKADSLSDLVTRQMDAFTRVQNNLGNWEK
ETQQLLQTGKDGRQSSGQLLSRANLAKSRAQEALSVGNATFYEVENILKNLREFDLQVED
RKAEAEEAMKRLSYISQKVADASDKTQQAERALGSAAADTQRAKNAAREALEISSEIAQE
IGGLNLEANGTADGALAMEKGLATLKSEMREVEGELARKELELDTDKDKVQLVITEAKQA
DARAKSAGVTIQDTLNTLDSILQLIDQSGSVDEEGLLLLEQELFQAKTQVNSQLRPLMSE
LEERARQQRNHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3570 nt   +upstreamnt  +downstreamnt
atgcccgcgctctggctcagctgctgcctggcgctcctgctgcccgcggcccaggccacc
tcccggagggaagtctgtgattgcaatgggaagtccaggcaatgtgtctttgatcaggag
ctccatcgacagacaggcagcgggttccgctgcctcaactgcaacgacaacactgccgga
gttcattgcgagaggtgccgggaggggttctaccggcagcgagacagagatcgctgccta
ccctgcaactgccactcaaaaggttctctcagtgctggatgtgacaactccggacagtgc
aggtgtaagccaggtgtgacaggacacaggtgtgaccgatgccagccaggcttccatacg
ctcactgatgctggctgtacccgagaccagagacaactagagtccaagtgtgactgcgac
ccagctggcatcgctggaccctgtgattccggccgctgtgtctgcaaggcagctgtcact
ggagctcgctgtgataggtgccgaccaggctactatcatctggacagggcaaaccctgag
gggtgtacccagtgtttctgctacgggcactcagccagctgccacagctctgcagacttc
agtgtccacaagatcacttcaactttctatcaggatgctgatggctggaaagcagttcag
aggaacggggctcctgcaaagctccactggtcgcctcgccaccaggacgtgttcagttct
gcccgaagatcggacccggtcttttttgtggcccctggcaaatttcttggtaatcagcaa
gtgagttatgggcagagcctgtcttttgactaccgagtagacagaggaggcaggcacccg
tcggcttacgatgtaatcctggaaggcgctggtctacagatccgagctcctctgatgccg
cttggcaagacgcttccctgtggaatcacaaagacttacacgttcagattaaatgaacac
ccaagcagtcagtggagcccccagctgagctactttgagtatcggaggctgctgcggaac
ctcacggccctcctgatccgagctacgtacggagagtacagcacggggtacattgacaac
gtgaccctgatctcagcccgccctgtctctggggccccagcaccctgggttgaacactgt
gtatgccctgctggctacaagggacagttctgccaagattgcgcctctggctacaaaaga
gattcagcgagactggggccttttggctcctgtattccctgtaactgccaaggaggcggg
gcctgcgatccagacacgggagattgctactcgggggatgagaaccctgacattgagtgt
gctgactgtcccattggtttctacaacgacccacacgacccccgcagctgcaagccgtgc
ccctgccacaatgggttcagctgctcagtgatgcctgagacggaggaggtggtgtgcaac
aattgcccccctggggtcacaggtgcccgctgtgagctctgtgctgatggctacttcggg
gatccctttggggaacgtggcccagtgaggccttgtcagcgctgccaatgtaacaacaac
gtggaccccagtgcctctgggaactgtgaccagttgacaggcaggtgtctgaagtgcatc
tacaacacagctggtctccactgtgaccagtgcaaggcaggttacttcggagacccgctg
gctcccaacccagcagacaagtgccgagcttgtagctgcaaccccatgggctcagagcct
ggagagtgccgaagcgatggcagctgcgtctgcaagccaggcttcgggggtcctaactgt
gagcccgcagccctcaccagttgtcctgcttgctacaatcaagtgaaaactcagatggac
cagtttacccagcagctccagagcctggaggccctggtttcaaaggctcagggtgatggt
ggcacagtccccagtgcggaactggaaggcaggatgcagcagttggaacaggccctccgg
gacattctacgagaagcccaggtttcagacggtgctaagagagccctcagtctccagctg
gccaaggcaaggagccaagagaacagctaccggaaccgcctggatgacctcaagatggct
gtggaaagggtccaggccctgggcagtcagtatcagaaccgagttcaggataccagtaga
ctcatctctcagatgcggctgggcctggcggaaagcgaagcttccctgcaaaatactaac
atccattcctcagagcattatgtggggccaaatggctttaaaagcctggctcaggaggcc
acaagattggcggacagccatgttgagtcagctaacacaatgaagcaactagcaagggaa
acagaggactattccaagcaagcgctttcactggcccgcgaggctctgagtggaggagga
ggaagcggcatcctggacagctctgtggtacaaggccttatgggaaaattagagaaaacc
aagtctctggcccagcagttgtcaagggaaagcacccaagccgactttgaagctgacagg
tcttatcaacacagtctccgccttctggattcagcgtcgcagcttcagggactcagtgat
ctgtcctttcaggtggaagcgaagaggatcaggcagaaagctgattctctctcagacctg
gttaccagacaaatggatgcgttcactcgggtgcagaacaatctggggaactgggaaaag
gaaacacagcagctgttacagaccggaaaggatggaagacagagttcaggtcagctgctc
tcccgtgccaacctggctaaaagcagagcgcaagaagcactaagtgtgggcaatgccact
ttttatgaagttgagaatatcctgaagaacctcagagagtttgatctgcaggttgaagac
agaaaagcagaggctgaagaggccatgaagagactctcctatattagccagaaggttgca
gatgccagtgacaagacccagcaagctgaaagggccctggggagtgctgctgctgacacc
caacgggcaaagaacgcagctagggaggccctggagatcagcagcgagatagcacaggag
attgggggtctgaacttggaagccaacgggacagcagatggggccttggccatggaaaag
ggactggccactctgaagagtgagatgagagaggtggaaggagagctggccaggaaagag
ctggagcttgacacagataaggacaaagtgcagctggtgattacggaagccaagcaggcc
gatgccagagccaagagtgccggagttacaatccaagacacgctcaacaccctggacagt
atcctacagctgatagatcagtctggcagcgtggatgaagaggggctgctgctgttagaa
caagagcttttccaagccaagacccaggtcaacagtcagctgcggcccttgatgtctgag
ctggaggagagggcgagacagcagaggaaccacctccacctgctggagacaagcatagat
ggaattctggctgatgtgaagaacctggagaacattagagacaacctgcccccaggctgc
tataacacccaggcgcttgagcaacagtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110552295
Entry
110552295         CDS       T05884                                 

Gene name
Lama1
Definition
(RefSeq) laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
mun05410  Hypertrophic cardiomyopathy
mun05412  Arrhythmogenic right ventricular cardiomyopathy
mun05414  Dilated cardiomyopathy
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110552295 (Lama1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110552295 (Lama1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110552295 (Lama1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110552295 (Lama1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110552295 (Lama1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110552295 (Lama1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110552295 (Lama1)
   05414 Dilated cardiomyopathy
    110552295 (Lama1)
   05416 Viral myocarditis
    110552295 (Lama1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110552295 (Lama1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110552295 (Lama1)
   05145 Toxoplasmosis
    110552295 (Lama1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_B Laminin_N Laminin_II Laminin_G_3
Other DBs
NCBI-GeneID: 110552295
NCBI-ProteinID: XP_021499160
LinkDB
Position
Unknown
AA seq 3088 aa
MRGGTGAALLGLLASVLWVTAQSQQRGLFPAILNLATNARISTNATCGEKGPEMFCKLVE
HVPGRPVRHAQCRVCDGNSTNPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLR
QVFQVAYIIIKAANAPRPGNWILERSVDGTEFKPWQYYAVSDTECLTRYKITPRRGPPTY
RADNEVICTSYYSKLVPLEHGEIHTSLINGRPSADDPSPQLLEFTSARYIRLRLQRIRTL
NADLMTLSHRDLRDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDEETKQLQCRCEH
NTCGESCDRCCPGYHQQPWKPGTISSGNECEECNCHNKAKDCYYDETVAKEKRSLNAAGQ
YSGGGVCVSCSQNTTGVNCETCVDRYYRPHKVSPYKDQPCRPCDCDPAGSLSSVCIKDDL
HADLANGKWPGQCSCKEGYAGDKCDRCQFGYRGFPNCVPCDCSTSGSVNDDPCTEPCLCK
KNVAGKNCDRCKPGFYNLKERNPQGCSECFCFGVSDVCDSLTWSVTQVTNMSGWLVTDLV
SPNKIRSQQDALGGRRQVSINNTAVMQRLTSTYYWAAPEAYLGNKLTAFGGFLKYTVSYD
IPVETADSDLTSHDDVIIKGNGLTVSTQAEGLSLQPYEEHFNVVRLVPENFRDFNTRKAI
DRDHLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASPNAIDLAVATDVEHCECPQG
YTGTSCESCLPGYYRVDGILFGGICQPCECHGHASECDIHGICSACTHNTTGDHCEQCLP
GFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGQEVVCDQCAPGYTGAWCERCADG
YYGNPTVPGGACVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDAV
IAKNCRACNCHENGSLSGVCHLETGLCDCKPQVTGQQCDQCLTGYYGLDTGLGCEPCNCR
PEGSTSDECTEEGQCHCVPGVAGRTCDRCAHGFYGYQEGGCTPCDCAHTQNNCDPDSGEC
LCPPHTQGLKCEECEEAYWGLDPERGCQPCNCSVSGSTGAQCDALSGQCHCKEGFAGQSC
QRCSLGYRGFPDCVPCGCDLRGTRADTCDLEQGLCSCTKDNGTCSCKENVLGPQCGECRA
GTFALRADNPLGCSPCFCSGLSQLCSELQGFVRVPVTLASDQPLLRVVSQSNLQGTVEGV
HSQAPDTLLDAEAVRRHVQAEPFYWRLPRQFEGDQLLAYGGKLQYSVAFYSTHGTGTSNY
EPQVLLKGGQARKHVIYMDAPAPENGVRQDYQVEMKEEFWKYFNSVSEKHVTHSDFMSVL
SSVDYLLIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAASLLELCVCPPGTAGFSCQ
DCAPGYHRGKLPENSGRGPRPLLAPCVPCSCNNHSDVCDPETGHCLNCSEHTAGDHCERC
APGYYGKVIGLAGDCTPCTCPHLPPFSFSPTCVLEGDSDFRCDACIPGYEGQYCERCSAG
YHGNPRAAGGSCQKCDCNPQGSVHSDCDRATGQCVCKPGASGLRCEDCLPRHILTESECV
SCDDECVGTLLNDLDTVGNAVQSLNLTGVFPAPYGILSNLENTTKYLQKYLIKENAKKIR
AEIQLEGVAEQTENLKKELTRVLTSSQQVNKAVERTGNESQALATFIEHLHTKVKEIVEK
VATLNQTSREDFQPPISALQGMHQNISSLLGLMKDRNFTELHQNATLELEAAKDLLSRVQ
RKLQRPQESLKALLQEASSLLSNRSDELQAAEELLKEVDAKSQESSLLLLLAKANLKEFR
EKKLHVQGEQNLTSRLIAKGREWVDAARTHVATAQDNLTQLEHHRDALLLWSTKLRSHVD
NLVMQMSKRRARDLVHTAERHASELQGLAGLLHGDLENVRNVSLNATSAAHVHANIQMLM
GEAERLATAAQQTAARTSLTSESLVSQGEAVLQRTSRFLKESANARRRQQGISLKLDELK
NLMGQFQESVDNITRQTASSLLILRESPGGMREKGRKARELAAAANESAARTLENVLGWS
LKVLNTSEGLSRVNATAQETKHLLHNSTVATLLAGRKMKDMEMQANLLFDRLKPLRTLEE
NLSRNLSEIKLLISRARKQAASIKVAVSADRDCVRAYQPQISSTNYNTLTLNVKTQEPDN
LLFYLGSSTSSDFLAVETRRGKVAFLWDLGSGSARLEFPDVSINDNRWHSIYITRFGNMG
SLSVKEASSAESPPVKTSRSPGSAKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMG
EAFLNGKSIGLWNYIEREGKCKGCFGSSQNEDSSFHFDGSGYAVVEKTLRTTVTQILILF
STFSPNGLLFYLASNGTRDFLSIELVRGRVKVMVDLGSGPLTLMTDRRYNNGTWYKIAFQ
RNRKQGLLAVFDAYDTSDKETKQGETPGASSDLNRLEKDVIYVGGIPHSTALRKGVSSRS
YVGCIKNLEISRSTFDLLRNSYGVRKGCTLEPIQTASFPRGGYVEVPPKSLSPESSLLAT
FATENSSGIILAALGKDVEKAGWSRAHVPFFSIMLIEGRVEVHISSGDGTSLRKAILLSP
MGSYSDGQEHSISLVRNRRVITIQLDESSPVEMKLGPLAEGRTINISNLYIGGLPEDKET
PMIKMRSSFHGCIKNLVFDTELLDFTHATVSEQVELDTCWLAEEPKQSLHGERGELPPEP
PTLPEPAVTTSEPCAVDPAPGYAAGTHQFGLSQNSHLVLPLNQSDVRRRLQVQLTIRTFA
SSGLIFYVAHQNQMDYATLYLREGHLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYIKR
KGFMTVDGQESPSVAVVGNATTLDVEGKLYLGGLPVHYRARNTGMVTHSIPACLGEVTVN
GKQLDKDSPASAFAVGRCYAVAQEGTFFEGSGYAALVKEGYKVRLDLNITLEFRTSSKNG
VLLGISSAKVDAIGLEIVDGKVLFHVNNGAGRITATYEPRAPRTLCDGEWHTLHAHKSKH
CLVLTVDGNAVRAESPHTHSTSADTNDPIYVGGYPANVKQNCLSSQTSFQGCMRNLKLSR
GPQVQALDLSRAFDLRGVFPHSCPGPEP
NT seq 9267 nt   +upstreamnt  +downstreamnt
atgcgcggcggcacgggagccgcgctcttggggctcctggcctcggtgctctgggtcacc
gcgcagagccagcagagaggcttgttccccgccattctcaacctggccaccaatgcccgc
atcagcaccaatgccacctgtggtgagaaggggcctgagatgttctgcaagcttgtggag
cacgtgccgggccggcctgttcgacatgcccagtgccgggtctgtgatggcaacagtacg
aatcccagagagcgccacccaatatcacacgcgatagacggcaccaataactggtggcag
agccccagtattcaaaacgggagagagtatcactgggtcaccatcaccctggacttacgg
caggtctttcaagttgcgtatatcatcatcaaagccgccaatgcccctcgacctggaaac
tggatattggagcgctctgtggacggcactgagttcaaaccctggcagtactatgcagtc
agcgacaccgagtgtctgacacgctacaagatcactccgagacgggggcctcccacctac
agagcggacaacgaagtcatctgcacctcatattattctaaactggtgccgctcgagcac
ggagagattcacacgtcgctcatcaatggccgaccgagtgctgatgacccctcaccgcag
ttgctggagttcacctcagcacggtacatacgccttcgtctgcagcgcatcagaactctc
aatgccgatctcatgactctcagccaccgggacctcagagaccttgaccccattgtcacc
aggcgttactactattcaatcaaagacatttccgttggagggatgtgtatttgctacggc
catgctagcagctgcccatgggatgaagaaacaaagcaactgcagtgtcggtgtgagcac
aacacgtgtggggagagctgcgacaggtgctgccctggctaccatcagcagccctggaag
cccggaaccatttcgtcgggtaacgagtgtgaggaatgcaactgtcacaataaagccaaa
gactgttactacgacgagactgttgcaaaggagaagcgaagcctgaacgcagccgggcag
tacagtgggggaggggtttgtgtcagctgctcgcagaacaccacaggcgtcaactgtgaa
acgtgtgttgaccgatattacagacctcacaaggtttctccttacaaggaccagccttgc
cgcccctgtgactgtgaccctgcggggtctctgagttctgtctgtatcaaggatgacctc
catgctgacttagccaacgggaagtggccaggtcagtgttcatgtaaggaaggttatgca
ggagacaaatgtgaccgctgccagtttggctaccggggtttcccaaattgcgtcccgtgt
gactgcagcacttccggcagcgtgaatgatgacccgtgcacagagccgtgcctttgtaag
aaaaatgtcgcggggaagaactgtgatcgctgcaagccgggattctataacttgaaggaa
agaaacccccagggctgctccgagtgcttctgtttcggcgtctctgatgtctgcgacagc
ctcacgtggtccgttactcaggtgaccaatatgtcagggtggctggtcactgacttggtc
agccctaataagatccggtctcagcaggacgccctgggcgggcgccgtcaggtcagcatc
aacaacacagcagtcatgcagaggctgacgtccacatattactgggcagctcccgaggcc
tatctcggaaacaagttgacagcattcggcgggttcctgaaatacacagtgtcttacgac
atcccggtggagacggcggacagtgacctcacgtctcatgacgatgttatcatcaaggga
aatgggctcacagtcagcacacaggctgagggcctgtccctgcaaccctatgaggagcat
ttcaatgtggtgagacttgtgcccgagaacttccgggactttaataccagaaaggcgatt
gaccgcgaccatctcatgaccgtcctggccaatgtgacacatctcttgatcagagccaac
tataattctgctaaaatggctctctataggctggattctgtctctctggacatagcaagc
ccaaatgctatagacctggcagtagctactgatgtggaacactgcgaatgtccccaaggc
tacacggggacctcctgtgagtcctgcctccccggctactaccgggtggatgggatactc
ttcggaggaatctgtcagccctgcgagtgccacggccacgcgtccgagtgtgacattcac
ggaatttgctctgcatgtacacacaacaccacaggggaccactgtgagcagtgcctgcct
ggcttttacgggacaccttcacgtgggaccccaggggactgccagccttgtgcctgccct
ctctccattgactccaacaatttcagcccaacctgccacctgaccgatggacaggaagtg
gtgtgtgaccaatgtgcccccggttacacaggagcctggtgtgagagatgtgccgacggt
tactatggaaacccgacggtgccagggggagcctgtgtgccatgtaactgcagtgggaat
gtcgaccccctggaggctggccactgtgactctgtcacgggggaatgcctgaagtgcctg
tggaacacagacggcgcccattgtgagaggtgtgcggacggcttttacggagatgctgtg
attgccaaaaattgccgagcctgtaactgccatgaaaatggctccctttctggcgtctgc
catctggagactgggctgtgtgactgcaaacctcaggtgacaggacagcagtgtgaccag
tgcctgactggctattatgggctggacacagggcttggctgtgagccctgtaactgcaga
ccggagggctccacatcagacgagtgcacagaggaaggccagtgtcactgtgtaccaggc
gtagctgggaggacttgtgaccggtgtgcacatggcttctacggataccaggaaggtggc
tgcacaccttgtgactgcgcccatacccagaataactgtgaccctgattctggagagtgc
ctctgcccgcctcatactcagggtctgaagtgtgaggagtgtgaggaggcgtactggggc
ctggacccagagcgggggtgccagccttgcaactgcagtgtctcgggctccacaggtgcc
cagtgtgatgccctctctggtcagtgccactgcaaggaaggtttcgctgggcagagctgc
cagcggtgctccctgggctacagagggtttcctgactgtgttccctgtggctgcgacctg
aggggtacacgggcagacacctgcgacctggaacagggtctctgcagctgcacaaaggac
aatggcacctgctcttgcaaggagaacgtgctggggccgcagtgcggcgagtgccgagcc
ggcacctttgccttgcgagctgacaaccccctgggctgcagcccctgcttctgctccggc
ctgtcccagctctgctcggagcttcagggtttcgtgagggttccggtgacgttggcctcc
gatcagcccctgctgcgtgtggtctcacagagcaacctgcagggcacggtggaaggcgtg
cattcccaggctccggacaccctgctggacgcagaggctgtccgccggcacgtccaggcc
gagccgttttactggcggctaccacggcagtttgagggagaccagctcttggcctatggt
gggaagctgcagtacagcgtggccttctactctacccacggcaccggcacgtccaattat
gagcctcaggttctcctcaaaggaggtcaggccaggaagcatgtcatttatatggatgcc
ccagcaccagagaatggagtgagacaggattaccaagtggaaatgaaagaggagttttgg
aagtacttcaattctgtgtccgaaaagcatgttacacactccgatttcatgtctgtcctt
agcagtgttgactacctcctcatcaaggcatcgtatggccaagggctacagcaaagcaga
attgccaatatttccatggaggttggcaggaaggcagtagagctgcccgctgagggagag
gccgcgtccttgttagagctgtgtgtctgtcctcccggcactgctggattctcctgtcag
gactgtgctcctgggtaccacagagggaagctcccagaaaacagtggcaggggaccccgc
cctttgctggctccctgtgtgccctgcagttgcaacaaccacagtgatgtctgtgacccc
gaaactggccactgtctgaactgcagtgagcacacagctggagaccactgcgaacggtgt
gcccccggctactacggcaaggtgattgggctggccggagactgcaccccctgcacctgc
ccacatctccctcctttcagtttcagccccacctgtgttttggaaggtgacagtgatttc
cggtgtgatgcctgtatccctggctatgaaggacagtactgtgagaggtgctctgctggc
tatcatggcaacccccgagcagcaggtggcagctgccagaagtgtgactgtaacccccaa
ggctctgtccacagtgactgtgaccgcgcgactgggcagtgcgtttgcaagccaggagcc
tcggggctccgctgtgaggactgcctgccgagacacatcctgacggagagcgagtgtgtt
tcctgtgatgatgaatgtgtgggcaccttgctgaacgacctggatactgttggcaatgct
gttcagtctctgaatctcactggtgttttccctgctccatatggaattttgtcaaatctg
gaaaatacaactaaatatttgcagaagtatttaataaaagaaaatgctaagaagattcgg
gccgaaatccagctcgaaggtgttgcagaacaaacagaaaatctgaaaaaggagctcact
agggtgttaacaagcagtcagcaggtgaacaaggcagtggagaggaccggcaatgagagt
caagccctggccacgttcattgagcatctgcacaccaaagtcaaagaaatcgtggagaag
gtggcaacgctgaatcagacctcgcgtgaagatttccagccgcccatttctgctcttcag
ggcatgcatcagaacatctcctctctgctgggactcatgaaggacaggaatttcacagag
ctgcatcaaaatgccaccctcgaactcgaggccgctaaagacttactgtcacgagttcag
agaaagctccagaggcctcaggagagtttgaaggcactgctgcaagaggccagcagcctc
ctttcaaatcgcagtgatgagctgcaggctgcagaggagctcctgaaggaagtggatgct
aagagccaggagagcagcctcctgctgctccttgccaaggccaacctgaaagaattcaga
gagaaaaagctgcatgttcaaggtgagcaaaatttgacctccaggctcattgccaaaggg
agagaatgggtagatgctgccaggacccacgtggctactgcacaagacaacctaacacag
ctggagcatcaccgagatgcgctcctcctgtggagcactaaactcaggagccacgtggac
aacctggtcatgcagatgtccaaacggagagcccgcgacctcgtccacacagccgagcgc
cacgcctctgagctgcagggcctggcaggacttttgcacggagaccttgaaaatgttcga
aacgtgtccctgaacgccaccagcgcagcacacgtccacgccaacatccagatgctgatg
ggagaagcagagagactggccaccgccgctcagcagacagcggctaggacaagcttgacc
tccgagtccctggtttctcagggggaagcagtcctgcagcgcacgtccagatttctaaaa
gaaagtgccaatgccaggaggaggcagcaaggtatttcattgaagctggatgagttgaaa
aatttgatgggtcagtttcaagagagtgtggataacattacaaggcagaccgccagctcc
ctcctcatccttcgggaaagtcctggaggtatgagagagaaggggaggaaagccagagag
ctggccgcagcagccaacgagagcgcggcgaggaccctggagaatgtcctaggttggagc
ctgaaggtcctcaatacatccgagggcctatccagagtgaacgccacagctcaggagacg
aaacaccttctgcacaactccacagtggccaccctgttggctggaaggaaaatgaaagac
atggagatgcaagccaaccttctatttgatcgattgaagcctttgagaacgctggaagaa
aacctgagcagaaacctgtctgagatcaaactgctgatcagccgggcccggaaacaagcc
gcttcgatcaaagtcgccgtgtctgcagacagagactgtgtccgcgcctaccaacctcag
atttcttctaccaactataacaccttgacgctcaatgtgaagacgcaggagccggacaac
ctcctcttctacctcggcagcagcaccagctctgattttctcgcagtggagacacggcgg
gggaaggtggcctttctctgggacctgggctccgggtctgcaaggttggaattcccagat
gtctccatcaatgacaacagatggcatagcatctacataacaaggtttgggaacatgggg
tcgctgagcgtaaaggaagcaagctcagctgagagcccaccagtgaagactagcagatct
ccggggtcggcgaaagttctggacataaacaattcgacgctgatgtttgttggaggcctc
ggaggtcaaataaagaaatcccccgctgtgaaggtcactcattttaagggctgcatggga
gaggccttcttgaacggcaaatcgatcggcctgtggaattacatcgaaagagagggaaag
tgcaaaggctgctttggaagctcccagaatgaagactcttccttccatttcgacggaagt
gggtatgcggttgtggagaagacgctgcggactaccgtgacgcagatactgatactcttc
agcaccttctcccccaacgggctgcttttctacctggcctcaaatggcaccagggacttc
ctgtccattgagctggtccgcggcagggttaaagtgatggtggacctggggtcaggaccc
ctcactcttatgacagacaggcgctataacaatggaacctggtacaaaattgccttccag
cggaaccggaagcaaggactgctagctgtcttcgatgcatacgacaccagtgacaaggag
accaagcaaggagaaaccccaggagcctcctctgatctcaaccggctggagaaagatgtg
atttacgtgggcgggatacctcactctacagctcttaggaaaggggtcagcagcagaagc
tatgtaggctgtatcaagaacctggaaatatccaggtccacctttgatttgctgagaaat
tcctacggagtgagaaaaggctgtacactggagcccatccagactgcgagtttcccaaga
ggtggctacgtggaggtgccgcccaaatctctgtcgccagaatcatccctgctagccacg
ttcgccaccgagaacagcagtggcatcatcctggctgccctgggcaaggatgtggagaag
gccggctggtctcgggcacatgtgcccttcttttccatcatgctgattgaaggccgcgtc
gaagtgcacatcagttccggcgatgggaccagtctgaggaaggccatcctgctctccccc
atgggctcctatagcgacggacaagaacattccatctccctggttaggaatcggagagtt
atcaccatacaactggatgagagcagtcctgtagaaatgaagttggggccactagcagaa
ggaaggactatcaacatatccaacctgtacataggggggcttcctgaggacaaggagact
ccaatgatcaagatgaggtcttcattccatggatgtattaaaaacttggtcttcgacact
gaacttttggacttcacacatgcgactgtctcagaacaagtagagctggacacttgctgg
ctggcagaggagcccaagcagagcctgcacggagaacgtggggagctccccccagagccc
ccaactctaccagagcctgcagtcacaacctccgaaccatgcgcagtggacccggctcca
ggatacgctgcaggcactcaccagtttggcctgtcgcaaaacagccacttagtgttgcct
ttgaatcagtccgatgtccggagacggctccaggttcagctgaccatccggacatttgct
agcagtggcctcatcttctacgtagctcaccagaaccagatggactacgccacactgtac
ctccgtgagggccacctacacttcatgtttgaccttggcaagggccggaccaaggtctct
caccctgcactgctcagtgacggcaagtggcacacggtcaagacagagtacattaagaga
aagggcttcatgactgtggatggccaagagtcccccagtgtggccgtggtgggcaatgca
accaccctggacgtggaggggaagctgtacctaggaggccttcctgtccactacagggcc
aggaacactgggatggtcacccacagcatccctgcctgccttggggaggtgacagttaat
ggcaagcagctggataaagacagcccagcatctgcctttgctgtgggcaggtgctatgcc
gtggcccaggaaggaactttctttgaagggagtggatatgcagctcttgtcaaggaaggc
tacaaggttcgattggatttgaacatcacactggagttccggacttcctctaagaatggc
gtcctcttggggatcagcagtgctaaagtagatgccattggcctagagattgtagatggc
aaggtcttatttcatgtcaacaatggtgctggtaggataacagccacatatgagcccaga
gcccccagaactctctgtgatggggaatggcacacgctccacgcccacaaaagcaagcac
tgcctcgtcctgaccgtggatgggaatgctgttagggctgaaagtcctcacacccattcc
acttccgccgacaccaacgatcccatctatgtgggtggctatcctgccaatgtcaaacag
aactgcctgagcagccagacctcattccagggttgcatgcggaatctcaagctgagcagg
ggcccacaggtacaagccttggatctgagcagagcctttgacctaagaggggtcttcccg
cactcctgccctgggcctgagccctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110553478
Entry
110553478         CDS       T05884                                 

Gene name
Lama3
Definition
(RefSeq) laminin subunit alpha-3 isoform X1
  KO
K06240  laminin, alpha 3/5
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110553478 (Lama3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110553478 (Lama3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110553478 (Lama3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110553478 (Lama3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110553478 (Lama3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110553478 (Lama3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110553478 (Lama3)
   05145 Toxoplasmosis
    110553478 (Lama3)
SSDB
Motif
Pfam: Laminin_I Laminin_G_2 Laminin_G_1 Laminin_II Laminin_G_3 Laminin_EGF
Other DBs
NCBI-GeneID: 110553478
NCBI-ProteinID: XP_021501091
LinkDB
Position
Unknown
AA seq 1724 aa
MPPAVRWSAWRTGWLWIFGAALGQCLGYGSEQQRVAFLQHPGQNHLQASYMELRPSQGCR
PGYYRDKSLPAGRCVPCNCNGHSNRCQDGSGMCINCQHNTAGEHCERCQEGHYGNAIHGS
CSVCPCPHTNSFATGCAVEGGHVRCACKPGYTGAQCERCAPGYFGNPQKFGGSCQPCNCK
NDGQLGTCDPLTGDCVSQEPKDGSPAEECDDCDSCVTTLLNDLASMGEELRLAKAKLQGL
RVSTGALEQIRHMEMQAKDLRGQLLGFRSAISNHGSKIDGLEKELSHLNREFETLQEKAQ
VNSRRAQTLYNNIGQTTQSAKELDMKIKNVVQNVHILLKQIARPGGEGTELPVGGWSREL
AEAQRMMRELRGRDFKQHLREAEAEKREAQLLLNRIRAWLETHQVESNGLLKNIRDSLSD
YEARLQDLRALLQEAAAQAKQAAGLNQDNEGVLGTIQRQMKEINSLKNDFAKYLATADSS
LLQTNNLLQQMDRSQKEYETLAAALNGARQELSDKVRELSRSAGKTSLVVEAEKHAQSLQ
ELAKQLEEIKRNASGDELVRRAVDAATAYENILSAIAAAEDAANKAASASESAFQTVIKE
DLPRRAKTLSSDSDELLNEAKITQKKLQQEVRPALRSLQKTLKTVSVQRDLLDANLTAVR
DDLRGIQRGDIDSAISGARSTVRKANGITSEVLDGLSPIQTDLGRIKDSYGSTRREDFNK
ALSDANNSVKKLTRKLPDLFVKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAIP
MRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPDLRENGGTEDMFVMYLGNKDASKDYIG
MAVVDGQLTCVYNLGDREAEVQIDQVLTESETQEAVMDRVKFQRIYQFAKLNYTKEATSN
KPKAPGVYDLDGGSSNTLLNLDPENAVFYVGGYPPDFQLPSRLRFPPYKGCIELDDLNEN
VLSLYNFKTTFYLNTTEVEPCRRRKEESDKNYFEGTGYARIPTQLNAPFPNFIQTIQTTV
DRGLLFFAENQDNFISLVIEDGNLMVRYKLNSEPPKEKGIQNTINDGKDHLISITIGKAQ
KRMLINMNDHNIRIEGEIFDFGTYYLGGIPIAIRERFNISTPAFQGCMRNLKKTSGVVRL
NDTVGVTKKCSEDWKLVRTASFSSGGQMSFTNLDVPLPDRFQLSFGFQTFEPSGTLLHHQ
TRTSSLQVSLDDGHVELSTRDSSGPIFKSPQTYMDGLLHHVSVISDTSGLRLLIDDQALR
RNQRLPSFSNAQQSLRLGGGYFEGCISNVFVQRFSQSPEVLDLASKSTKRDASLGGCSLN
KPPFLMLFKGPKALNKARIFNVNQLLQDAPQAPRSMEAWQDGKSCLSPLSVKATHGALQF
GDSPTSHLLFKLPQELLKSRSQFSLDIQTTSSKGLVFYTGTKDSFMTLYISEGRLVFAVG
ADRKKLRLRSKERYRDGKWHTVVFGVSGGKACLVVDGLRAQEVSLPGNSTISHKAQVYLG
LPLSRKSKSLPQHSFVGCLRNFQLDSKPLDSPSARFGVSPCLGGSLEKGIYFSQGGGHVV
LANSVSLVPELKLIFSIRPRSLTGILIHIGSQFGQHLSVYMEAGKVTASLDSEAGGTLTS
ITPKQSLCDGQWHSVAVSIKEHILHLELDTDNSYTAGQLSFPPNNTRGSLHIGGVPHKLK
MPMLPVWNSYFGCLKNLQVNHVPVPITEATEAQGSVSLNGCPDH
NT seq 5175 nt   +upstreamnt  +downstreamnt
atgcccccggcagtgaggtggtcagcctggaggacaggatggctgtggatctttggggca
gccctgggccagtgcctggggtatggatcagagcagcaaagggtagcctttcttcagcat
ccaggtcaaaatcatctgcaagcaagttatatggagcttagacccagccagggttgtcgc
cctggatactatcgggacaaaagcttgcctgccggaaggtgtgttccctgcaattgcaat
ggacactcaaatcgctgccaggatggctcgggaatgtgcattaactgccagcacaacaca
gctggggagcactgtgagcgctgccaggagggtcactatggaaacgccatccacggatcc
tgtagcgtctgcccctgccctcataccaacagttttgccactggctgtgctgtggaagga
ggacatgtgaggtgtgcctgcaaacccggatacacaggagcacagtgtgagaggtgtgca
cccggatattttgggaatccccagaaatttggaggcagctgccaaccatgcaattgtaaa
aacgatggccagttaggcacttgtgaccctctaactggagactgtgtaagccaagaaccc
aaagatggcagccctgcagaagaatgcgatgattgtgacagctgcgtgacgacgctcctg
aatgacttggcctccatgggtgaggagctccgcctagcgaaggcaaagctgcagggcctg
agagtgagcactggcgctctagaacagatccggcacatggagatgcaggccaaggacctg
aggggccagctgcttggcttccgctctgccatctcaaatcatgggtccaaaatagacggc
ctggaaaaagaactgagtcatctgaaccgcgaatttgaaactttgcaagaaaaggcgcaa
gtaaattccagaagagcacaaacattatacaacaacataggtcagacaacccaaagcgcc
aaagaactggacatgaagattaaaaacgtcgtccagaatgtgcacattctcctgaagcag
atcgcaaggccaggtggagagggaacggagctgccagtgggcggctggtccagggagctg
gcggaagcccagcgcatgatgcgggagctgcgaggccgggacttcaaacagcacctcaga
gaagcagaggcagagaaaagagaagcccagctcctgctgaaccgcatcagggcctggctg
gaaacccaccaggtggagagcaacgggctgctgaagaatatccgggattcgctaagtgat
tacgaagccagacttcaggacctgcgcgccctcctccaggaggcagctgcccaggcaaag
caggctgccggcctcaaccaggacaatgagggggtgctgggaaccatccagagacaaatg
aaagaaataaactccctgaagaatgacttcgccaagtacctggccacggcagactcctcc
ctgctgcagaccaacaacctactgcagcagatggacagaagccagaaggaatatgaaacc
ttagctgctgctttaaatggagcaaggcaggaactaagtgacaaagtgcgagaactttcc
agatcggccggcaaaacgtccctggtggtggaggcagagaagcatgcgcagtcattacag
gagctggcaaagcagctggaagagataaagagaaacgccagtggggacgagctggtgcgc
cgtgctgtggacgctgccacagcctatgagaacatcctcagtgccatcgcagccgcagag
gacgcagccaacaaggccgccagtgcctcggagtccgccttccagacagtgataaaggaa
gatcttccaagaagagccaagaccctgagttctgacagtgatgaactgttaaatgaagcc
aagatcacacagaaaaagctacagcaagaagtccgtccagctctcagaagcctgcagaaa
accctgaagactgtgtcggtccagagagacctgctcgatgccaacctcaccgctgtccgt
gatgatcttcgtgggatacagagaggtgatatcgacagtgcgatcagtggtgcgaggagc
acggtcaggaaggccaatgggataacaagcgaggttctcgatgggctcagccccatccag
acagatttgggaagaattaaggacagctatgggagcacccggcgtgaggacttcaacaag
gctctgagtgatgccaataactcagtaaagaaattaaccaggaagctgcctgatcttttt
gtcaagattgaaagtatcaaccaacagttgctgcctctgggaaacatctctgacaatgta
gaccgaatccgagaactcatccagcaggccagagacgctgcgaataaggttgcgattccc
atgaggttcaatggtaaatctggcgtcgaagtccggctgccaaacgacctggaagacttg
aaaggatacacgtccctgtctttgtttctccaaagacctgacttaagagagaacgggggc
accgaggacatgtttgtgatgtacctcggaaataaggatgcctccaaggactacataggc
atggcagttgtagacggccagctgacatgtgtctacaacctgggagatcgagaagccgaa
gtccagatagaccaggtgctgacggagagcgagacgcaggaggcggtcatggacagggtg
aagttccagagaatttatcagttcgcaaagcttaattacaccaaagaagccacatccaat
aagcccaaggctcccggggtctatgacctggacggcggcagcagcaacacgctcctcaat
ctggaccctgagaatgccgtgttttatgttggaggctacccgccggattttcagcttcct
agcagactgaggttccctccctacaagggctgcatcgagctagatgacctcaacgaaaac
gtcctgagcctgtacaacttcaagacaacgttctatctcaacaccaccgaggtggaaccg
tgcaggaggagaaaggaagagtcggacaaaaattactttgaagggacaggctatgctcgc
attcccactcagcttaacgctcccttcccgaacttcatccagactatccagactactgtg
gacagaggcttgctcttcttcgccgagaaccaggacaacttcatatccctggttatagaa
gacggcaatctcatggtgagatacaaactgaattcagagccacccaaagagaaaggaatt
caaaacaccatcaacgacgggaaagaccatttgatttcaatcacaattggaaaagcacag
aaacgcatgttgataaatatgaatgaccataatataagaatcgaaggggaaatatttgat
ttcggcacgtattatttgggaggaattccaattgcaatcagagaaaggtttaacatctcc
acacctgctttccaaggctgcatgaggaacctgaagaaaaccagtggtgtggtcaggctg
aacgacaccgtgggtgtgaccaaaaagtgctctgaagactggaagctcgtgcgaacggcc
tcattctccagcggaggacagatgagttttacaaacctggacgtgcccttgcctgaccgc
ttccagctctcctttgggtttcagacctttgagcccagtgggacactgctccatcatcag
acgcggacgagtagcctgcaggtcagcctggacgacggccacgttgagctgagcactagg
gacagcagtggccccattttcaagtccccacagacctacatggacggcttactgcatcac
gtgtctgtgataagcgacacctcaggcctccgccttctcatcgacgaccaggctctgaga
aggaaccagaggctgcccagcttctccaacgcccagcagtctctccgcctgggaggcggt
tactttgagggttgcatcagcaatgtttttgtccagaggttttcacaaagtccagaagtc
ttggacttggccagtaaatctaccaagagggacgcatccctgggaggctgcagtttaaac
aaaccaccttttcttatgctatttaaaggccccaaggcacttaacaaagccaggattttc
aatgtcaatcagctgctgcaggatgcgcctcaggcccccaggagcatggaggcttggcaa
gacgggaagtcctgcctgtcacctctcagtgtcaaggccactcacggagccctccagttc
ggggacagtcccactagccacctgctattcaagctgccccaggagttgctgaaatctagg
tcacagttttctttggacattcagacaacatcctccaaaggtctggtgttttacacaggc
accaaggactccttcatgactctttatatctcagaaggacgtcttgtctttgctgtgggg
gccgaccggaagaaactgaggctcaggagcaaggagcgataccgagatgggaagtggcac
acggtggtgttcggagtaagtggaggaaaggcgtgcttggttgtggatgggctaagggcc
caggaagtcagtctgcctggaaattctaccatcagccacaaagcacaggtttacctgggg
ttaccactgtcaagaaagtcaaagagccttccccaacacagttttgtggggtgcctgagg
aacttccagttggactcaaaacccctggactccccctctgcgaggtttggggtgtctccc
tgcctgggtggctctctggagaaaggcatttacttctcccaaggaggaggccatgtggtc
ctagccaattctgtgtccttggtgccagagcttaagcttattttcagcattcgcccgagg
agtctcactgggatcttaatacacatcggaagtcaatttggacagcacttgagtgtttac
atggaggcgggaaaggtcacggcctctctggacagtgaggctggtgggaccttgacgtca
atcacaccaaagcagtccctgtgtgacggacagtggcactcagtggcagtctccattaaa
gagcacatcctgcacctggaactggacacagacaacagctacaccgctggtcagctttcc
ttcccccctaacaatacccgagggtcgctgcacattggaggtgtcccacacaaattgaaa
atgcccatgctccctgtatggaactcatattttggctgtctgaagaatcttcaggtcaac
cacgtccctgtccccatcacagaagccacagaagcccagggttctgtcagcctgaatggc
tgccctgaccactaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110554009
Entry
110554009         CDS       T05884                                 

Gene name
Lama5
Definition
(RefSeq) laminin subunit alpha-5
  KO
K06240  laminin, alpha 3/5
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110554009 (Lama5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110554009 (Lama5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110554009 (Lama5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110554009 (Lama5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110554009 (Lama5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110554009 (Lama5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110554009 (Lama5)
   05145 Toxoplasmosis
    110554009 (Lama5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_B Laminin_G_3 DUF5738
Other DBs
NCBI-GeneID: 110554009
NCBI-ProteinID: XP_021502012
LinkDB
Position
Unknown
AA seq 3738 aa
MAKPGGRLSAGSAPRACGSRSPAPPPPPLLLLLAGLALLGEARTPGGDGFSLHPPYFNLA
EGARITASATCGEEALTRSASRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNK
AHPVSNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLE
RSTDFGHTYQPWQFFASSKRDCLERFGPRTLDRITQDDDVICTTEYSRIVPLENGEIVVS
LVNGRPGAMNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKD
ISIGGRCVCHGHADVCDAKDPSDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDSA
NECQSCNCHGHAYDCYYDPEVDRRNASQNQDNVYQGGGVCLDCQHHTTGINCERCLPGFY
RAPDQPLDSPHVCRPCNCESDFTDGTCEDLTGRCYCRPNFTGEQCAACAEGYTNFPHCYA
VPSFPHNDTREQLLPAGQIVNCDCSAAGTQGNACRKDPRLGRCVCKPNFQGTHCELCAPG
FYGPSCQPCQCSSPGVADGLCDPESGRCTCRAGFEGDRCDRCAPGYFRFPLCQLCGCSPS
GTLPEGCDETGRCRCRPGFDGPHCDRCLPGYHGYPDCRACACDPRGALDQHCGVGGACRC
HPGYTGTTCQECSPGFHSFPSCIPCHCSADGSLHTTCDPTTGQCSCRPRVTGLRCDVCVP
GAYNFPYCEAGSCHPAGLAPANPALPEAQAPCTCRAHVEGPSCDHCKPGYWGLSPSNPEG
CTRCSCDPRGTLGGVTECQLGNGQCFCKAHVCGQTCAACKDGFFGLDHADYFGCRSCRCD
VGGALGQGCEPRTGACRCRPNTQGPTCSQPAKDHYLPDLHHMRLELEEAATPEGHAVRFG
FNPLEFENFSWRGYAHMTAIQPRIVARLNVTSPDLFRLVFRYVNRGPQSVNGRVSVHEEG
KFSSCSNCTEQSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGIWALLVEAEGVLLDYVVL
LPSTYYEAALLQHRVTEACTYRPSALQSIENCLLYAHLPLDGFPSAAGTDALCRRDNSLP
RPCPTEQLSPSHPPLATCVGSDVDIQLEMAVPRPGRYALVVEYVSEDSHQEVGVAVHTPQ
RGPQQGMLNLHPCPYSSLCRGPARDSQHHVATFHLDSEASIRLTAEQANFFLHSVTLVPV
EEFSTEFVEPRVYCVSSHGTFNPGSSSCLPSRFPKPPQPIILKDCQVLPLPPDLPLTQSQ
ELTPGAPPAGPQPRPPTAVDPNAEPTLLRHPQGTVVFTTQVPTLGRYAFLLHSYQPVYPT
FPVEVLINGGRVWQGHANASFCPHGYGCRTLVLCEGQTMLDVTDNELTVTVRVPEGRWLW
LDYILIVPEDVYSSSYLHEEPLDKSYDFISHCATNGYHISPSSSSLFCRNAATSLSLYYN
NGALPCGCHEVGAISPTCEPFGGQCPCRGRVIGRDCSRCATGYWGFPNCRPCDCGARLCD
ELTGQCICPPRTVPPDCLACQPQSFGCHPLVGCEECNCSGPGVQELTDPTCDMDSGQCKC
RPNVAGRRCDTCAPGFYGYPSCHPCDCHEAGTMASICDPLTGQCHCKENVQGSRCDQCRL
GTFSLDAANPKGCTRCFCFGATERCGSSNHARHEFVDMEGWVLLSSDRQVVPHEYRPEME
LLHAGLRLVADTFPELYWQAPPSYLGDRVSSYGGTLHYELHSETQRGDVFVPYESRPDVV
LQGNQMSIAFLELAYPPPGHIHRVQLQLVEGNFRHLETHNPVSREELMMVLAGLEQLQIR
ALFSQTSATVSLRRVVLEVASEAGRGPPASNVELCMCPANYRGDSCQECAPGYYRDTKGL
FLGRCVPCHCHGHSDQCLPGSGTCVGCQHNTEGDQCERCRAGFVSSDPNDPAAPCVSCPC
PLAVPSNNFADGCIIRNGRTQCLCRPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNG
DPNMIFSDCDPLTGACRGCLRHTTGPHCESCAPGFYGNALLPGNCTRCECSPCGTEACDP
QSGRCLCKAGVTGPHCDRCLEGHFGFEQCQGCQPCACGPAAKGSECHPQSGQCHCQPGTT
GPQCRECAPGYWGLPEKGCRRCQCPRGHCDPHTGRCTCPPGLSGERCDTCSQQYQVPVPG
GPGAHGIHCEVCDHCVVLLLDDLERAGALLPSIRDQLQGINASSVAWARLHKLNASIADL
KSKLRSPLGPRYQTAQQLQTLEQQSASLQQDAERLGSQATAAQDRAAQLLDNTEATLDRA
QMLLETVHALDRYLSELASRIGQVSPDNASVPSGEQLRRALAEVERLLWEMRTRDLGAPR
AVAEAELTEAQRLMARVQEQLTNLWEENQSLATQIRDQLAQYEAGLMDLREALNHAVNTT
READELNSLNQERLKEALQWKQELSQDNATLKATLQAASLILGHVSELLQGMDQAKEDLE
HLAASLDGAWTPLLKKMEAFSPASSKVDLVEAAEAHAQKLHQLAINLSGIILGINQDRFI
QRAVEASNAYSSILQAVQAAEDASGQALRQASRAWETVVRRGLAAAAQQLLANSSALERT
VLGYQERLGLAQGRLQAAGTQLHDVRAKKDQLSAQIQEAQAMLAMDTSETSDKIAHAKAV
AAEARDTAAHVQSQLQNIHKNVERWQSQLGGLRGQDLGQVERDASSSVSTLEKTLPQLLA
KLSRLENRVVHNASLALSANIGRVRKLIAQARSAANKVKVSMKFNGRSGVQLRTPRDLAD
LAAYTALKFYIQSPVPAPAPGENTGDRFVLYMGSRQATGDYMGVSLRNQKVHWVYRLGKA
GPTTLSIDENIGEQFAAVSIDRTLQFGHMSVTVEKQMVHEIKGDTVAPGMEGLLSLQPDD
FVFYVGGYPSNFTPPEPLRFPGYLGCIEMDTLNEEVVSLYNFKQTFKLDTAVDKPCARSK
ATGDPWLTDGSYLDGSGFARITFEKQFSNTKRFEQELRLVSYNGIIFFLKQESQFLCLAV
QEGTLVLFYDFGSGLKKAEPLQPPQALTAASKAIQVFLLATNRKRVLVRVERATVFSVDQ
DNMLEMADAYYLGGVPPEQLPPSLRQLFPSGGSIRGCIKGIKALGKYVDLKRLNTTGISF
GCTADLLVGRTMTFHGHGFLPLALPDVAPITGEVYSGFGFRGIQDNSLLYYRTSPDGPYM
VSLKQGHVTLQFMRTEVETQGAFADGAPHYVAFYSNATGVWLYVDDQLQQTKSHQGTFPM
LQLQPEEPPQLLLGGLPMSGTFHNFSGCISNVFVQRLRGPQRVFDLQQNTGSVNVSIGCT
PAQLVQTSRATVQKVSRRSRQPSQDLACPTPWLLGTIQGAYQFGGPQPSYLQFVDVSPSH
RNRLHFSMLVRPQAASQGLLLSAAPMSSHSPSLLLFLSHGHFVAQTEGPGPRLQVQSRQH
SRAGQWHRVSVRWGTQRVQLVVDGSQTWSQKALHHWVHRAESPQPYTLFVGGLPASSYSS
KLPVSVGFNGCMKKLQLDKRPLRAPTRMVGVTPCVSGPLEDGLFFPGSEGIVTLEFPKAK
LSYVSLELEVRPLAAAGLIFHLGQTQATSYVQLQVLTEQVLLRANDGAGEFATWVTYPKL
CDGQWHRVAVTKGRNSLQLEVDMESNHTTGPLPATLADSPALLHLGGLPKARTAQSETPA
YRGCMRKLVLDGAPITMMASAQIQGAVGMSGCPSGTVVPDPAHSSAPSKQGKALTQRQVG
SSRLWKIKPSELPLLQQR
NT seq 11217 nt   +upstreamnt  +downstreamnt
atggcgaagcccggagggcggctcagcgcggggagcgcaccgcgcgcttgtggctcccgg
agccccgcgccgccgccgccgccgctgctgctgctgttggctgggctggcgctgttaggc
gaggcgcggactcccgggggcgatggcttcagcctgcacccgccctacttcaacctggcg
gagggcgctcgcatcaccgcgtctgcgacctgcggagaggaggccctgacgcgcagtgcc
tcacgccccaccgaggacctatactgcaagctggttgggggtccggtggccggcggagat
cccaaccagaccatccagggccagtactgtgacatctgtacagctgccaacagcaacaag
gcccaccctgtgagcaacgccatcgatggcacagagcgctggtggcagagcccacccctg
tcccgtggcctggagtacaatgaggtcaacgtcacactggacctgggccaggtattccat
gtggcctacgtgctcatcaagtttgccaattctccgcggcctgacctctgggtcttggag
cggtccacagacttcggccacacttaccagccatggcagttctttgcctcctccaagagg
gattgcttggagcggtttggacctcggactctagatcgcatcacacaggatgacgatgtc
atctgtaccacagagtactctcggatagtgcccctggagaacggcgagattgtggtgtcc
ttggtgaacgggcgccccggggccatgaacttctcctattcaccactcctccgagacttc
accaaggccaccaacatccgcctgcggttcctgcgaaccaacacactactgggccacctt
atgggcaaggcgctgcgggaccccaccgtcacccgaaggtactattacagcatcaaagac
atcagcatcggcggccgctgcgtctgtcatggccatgcggatgtgtgtgatgctaaggac
ccctccgatcctttcaggctacagtgtgcctgccaacacaacacatgtggaggctcttgt
gaccgatgctgtccaggcttcaaccagcagccatggaagcccgccaccaccgacagcgcc
aatgagtgccagtcctgcaactgccatggccatgcctatgactgttactatgaccctgaa
gtggaccggcgcaatgccagccagaaccaggacaatgtgtaccagggtggaggtgtctgc
ctcgattgccagcaccacaccacaggcatcaactgtgagcgctgcctgcctggcttctac
cgcgcccctgaccagcccctggactcaccgcatgtctgtcgcccctgtaactgtgagtcg
gacttcactgatgggacatgtgaagacttaacaggccgctgttactgcaggccgaacttc
acaggagagcagtgtgctgcctgtgccgagggctacaccaatttcccacactgctacgct
gtaccttcatttccccacaacgacacccgagaacaattgctgcctgctggacagatcgtg
aattgtgactgcagtgctgcagggacccagggcaatgcctgccggaaggacccacggttg
ggccgctgtgtgtgcaaacccaacttccagggcacccactgtgagctctgtgcacctgga
ttctatggccctagctgccaaccatgccagtgttccagccctggggtagccgatggcctc
tgtgaccccgagtcaggccggtgcacatgccgcgcaggcttcgagggggaccggtgtgat
cgctgtgcccccggctacttccgcttccctctctgtcagctgtgtggctgtagcccttca
gggacgctgcctgaaggctgtgacgagactggacgctgccggtgccgacctgggtttgac
ggccctcactgtgaccgctgcctcccgggctaccatggttaccccgactgtcgtgcttgt
gcctgtgaccctcggggggccctggatcaacactgcggagtgggcggggcatgccgctgc
catcccggctacacaggcaccacttgccaggagtgcagccctggcttccacagcttcccc
agctgcatcccctgccactgctctgctgatggttccttgcataccacctgtgaccccaca
accgggcagtgtagctgccggccccgagtgacggggctgcgctgtgatgtgtgtgtgcca
ggtgcctataacttcccctactgtgaagctggctcttgtcatcctgctggtctggcccca
gccaatcctgcccttcctgaggcacaggctccctgtacatgccgggctcacgtggagggg
ccaagctgtgatcactgtaaacctgggtactgggggctgagccccagcaaccctgaaggt
tgcacacgctgcagctgtgacccacgaggcacattgggtggagttaccgagtgccagttg
ggcaacgggcagtgtttctgcaaggcccatgtgtgtggccagacctgtgcagcctgcaag
gatggcttctttggtctggatcatgcagactactttggctgccgaagctgccggtgtgat
gttggtggtgccttaggccagggctgcgaacccaggacaggcgcctgcaggtgccgccct
aacacccagggccccacctgcagccagccagcgaaggaccactacctgccggacctacac
cacatgcggctggagctggaggaggcggccacccccgagggccacgctgtacgctttggc
tttaatcctctggagtttgagaacttcagctggagaggctacgcacacatgacggctatc
cagcccaggattgtggccaggctgaacgtgacctcccccgacctgtttcgtctggtcttc
cgctatgtcaaccgtggaccgcagagtgtgaatgggcgggtctccgttcatgaagagggc
aagttttctagctgttccaactgcaccgagcagagccagccagtggccttcccacccagc
acagagcctgcctttgtcactgtgccccagaggggctttggggaaccctttgtgctgaac
cctggcatctgggccttgctggtggaggctgaaggtgtactcttggactacgtggtcctg
ctgcccagcacctactatgaggcggctctcctccagcatcgtgtgactgaggcctgtacc
taccgcccctcggctctgcagtccatagagaactgcctcctctatgctcacctacccctg
gatggcttcccttcagcggctggaactgacgccctctgtcgccgtgacaacagtctgcca
aggccttgtcccacagagcagctcagcccttcacacccaccgctggcgacctgcgttggc
agtgatgtggacatccagcttgagatggcagtgcctcggccaggccgatatgctctggtg
gtggagtatgtcagtgaggattcacaccaggaggtgggtgtggctgtgcacacccctcag
aggggcccccagcaagggatgctcaacctccacccctgcccatacagctccctgtgccgg
ggtccagctcgggatagccagcatcatgtggccacctttcacctggactccgaggccagc
atccggctcactgccgagcaggccaacttcttcctgcacagcgtcaccctggtgcctgtg
gaggagttcagcacagagtttgtggagccccgagtctattgtgtgagcagccatggcacc
ttcaaccccggcagttcttcctgcctgccctcccgatttccgaagcccccgcagcccatc
atccttaaggactgccaggtcttgccgctgcctcccgacctgcctctgacccagtcacag
gagctcacaccaggtgcacccccagctggaccacaacctcggcccccaaccgctgtggac
cccaacgcagagcccaccttgctgcgccacccacagggcactgtggtcttcaccacccag
gtgcccaccctgggccgctatgccttcctgctgcacagctaccagccagtgtacccaacc
ttccctgtggaggtcctcatcaacggtggccgcgtctggcagggccacgccaatgccagc
ttctgcccacatggttatggctgccgtaccctggtgttgtgcgagggtcagactatgctg
gatgtcacagacaacgagctcaccgtgaccgtgcgtgtgccggaaggccggtggctctgg
ctggactacatactcatcgtccctgaggatgtttatagctccagttacctccatgaggag
cccctggacaaatcctacgacttcatcagccattgtgccaccaatggctaccacatcagc
cccagcagctcatctctgttctgccggaatgccgccacctccctgtctctctactacaat
aatggggccctaccttgtggctgccacgaggtgggtgccataagccccacgtgtgaaccc
ttcgggggccagtgtccctgccggggccgcgtcattggccgtgactgctcccgctgtgcc
accggctactggggcttccccaactgcaggccctgtgactgtggtgcccgcctgtgcgat
gagctcacaggtcagtgtatctgtccacctcgcaccgtcccccccgactgcctggcctgc
cagccccagagctttggctgccatcccctggttggctgtgaggagtgtaactgctcaggg
cctggtgtccaggagctgacggaccccacctgtgacatggacagcggccagtgcaaatgc
cgacccaacgtagctgggcgtcgctgtgacacctgtgccccaggcttctatggttatccc
agctgtcatccctgtgactgccatgaggcaggcaccatggctagcatatgtgaccccctc
acaggccagtgccattgcaaggagaacgtacagggctcaaggtgtgaccagtgccgcctg
gggaccttctccttggacgctgctaaccccaagggctgtacccgctgcttctgtttcggg
gccactgagcgctgtgggagctctaaccatgcccgccatgagtttgtggacatggagggc
tgggtactcttgagcagtgaccgccaggtggtacctcacgagtatcggcccgagatggag
ctgctgcacgcgggtctgcgccttgtggctgacacgtttccagagctgtactggcaagcc
ccgccctcctacctgggagacagggtgtcctcctacggcgggacccttcactatgagctg
cactcggagacccagcgtggcgacgtcttcgttccctatgagagccggccggacgtggtg
ctgcagggcaaccaaatgagcatcgccttcctggagctggcgtaccctccccctggccac
attcaccgggtacagctgcagttggtagaggggaacttccggcacttggagactcacaac
ccagtgtcccgagaagaacttatgatggtgctggctggcctggagcagctgcagatccga
gcgctcttctcccagacctctgccacagtctccttgcgtagagtggtgctagaggtggct
agtgaggctggcaggggccctccagccagtaacgtcgaactgtgcatgtgccctgccaac
taccgtggagactcatgccaggaatgtgcccctggctattaccgggacaccaaaggtctt
ttcctgggccgatgtgtcccctgtcactgccatggccattcggaccaatgccttcctggc
tctggcacctgtgtgggctgccagcacaatacagaaggggaccagtgtgagcgctgcagg
gctggcttcgtgagcagtgatcccaatgaccctgcagctccctgtgtgagctgcccttgc
cccttagcagtaccttccaacaactttgcagatggttgcatcataagaaacggccgaacc
cagtgcctctgcagaccaggctatgctggggcctcctgtgaacggtgtgctcctggcttt
tttggaaaccctctggtgctgggaagctcctgtcagccctgtgactgcagtggcaatgga
gaccccaacatgatcttcagtgactgcgacccgctgacaggcgcctgtcgaggctgcctc
cgtcacaccactgggccccactgtgagagctgcgcccctggcttctatggcaatgctttg
ttgcctggcaactgcaccaggtgtgagtgttccccatgtgggacagaagcttgtgatcct
cagagtgggcgctgcctgtgcaaggcaggtgtgactggaccacactgtgaccgctgtctg
gaaggacacttcggctttgagcaatgccagggctgccagccttgtgcctgtggaccagct
gccaagggctctgagtgccaccctcagagcggtcagtgtcactgccagccagggaccaca
ggaccccagtgccgagagtgtgcccctggctactggggcctcccggagaagggctgcagg
cgctgccagtgtccacgaggccactgcgacccacacacaggccgctgcacctgtccccca
ggactcagtggagagcgctgtgacacctgcagccagcagtaccaggtgcctgtgcccggc
gggcctggggcccatggcatacactgtgaagtgtgtgaccactgtgtggtcctgcttctg
gatgacctcgagcgggctggtgccctcctcccctccatccgtgatcagctgcagggcatc
aatgccagctccgtagcctgggccaggctgcacaagcttaatgcctccattgctgacctg
aagagtaagctccggagcccactgggaccccgctaccagacagcacaacagctgcagact
ctagagcaacaaagtgcaagccttcaacaggatgctgagcgcctaggcagtcaggccaca
gcggcccaagatcgggcggcccagctgctggacaacacagaggccacactggaccgggca
cagatgctgttggagactgtgcatgctttggaccgttacctaagtgagctggcatctcga
ataggccaagtgtccccagacaatgcctcagtaccgtctggtgagcagctgcgccgggca
ctggctgaagtggagcggctactctgggaaatgcggactcgtgacctgggggccccacgg
gcagtggcagaggccgaactgacagaagcccagaggctgatggctcgtgtacaggagcag
ctcaccaacttatgggaggagaaccagtcattggccacacagattcgggaccagctggcc
cagtatgaggctggcctcatggacctccgtgaggccctgaaccacgcagtcaataccacc
cgggaggctgatgaactcaacagcctcaaccaggagcggctgaaagaagccctgcaatgg
aaacaggagctatcccaggataatgccaccttaaaggccacccttcaggctgccagcctc
attttgggccatgtttctgagcttctgcagggcatggaccaggctaaggaggatctagag
catctggcagccagcctggatggagcctggactcccttactgaagaagatggaggccttc
tccccagctagtagcaaggtggatttggtagaggctgcggaggcccatgctcagaagctg
caccagctggcgatcaacctgtctggcatcatccttggcatcaatcaggaccgcttcatt
caaagggctgtggaagcctccaatgcctacagcagcatcctgcaggccgttcaggctgct
gaggatgcctcaggccaggcactgaggcaggccagccgcgcgtgggagacggtggtgagg
cggggccttgcagctgcagcccaacagctgttagccaacagcagtgcactggagaggacc
gtccttgggtaccaggagagactgggccttgctcagggccgcctacaggctgcaggaacc
cagcttcatgatgtccgggccaagaaggaccagctgtcagcccagatccaggaggcacaa
gccatgctggccatggacacaagtgagaccagtgacaagattgctcatgccaaggctgtg
gctgctgaagcccgggacacagccgcccatgtgcagtcccagcttcagaacatacacaag
aacgtggagcgatggcagagccagttggggggcctgcgaggccaggacctgggccaggtg
gagcgtgatgcaagcagttcagtgtccaccctggagaagacattgccacagctgctggcc
aaactgagccgtctggagaaccgtgtggtgcataacgccagcctggccttgtccgccaac
attggtcgtgtgcgcaagctcatcgcccaagcccggagtgccgccaacaaggtcaaggtg
tccatgaagtttaatgggcgttcaggggtgcagctgcgtaccccgcgagaccttgctgac
cttgctgcctacactgccctcaagttctacatccagagcccagtgccagcgccagcacct
ggcgagaacactggagaccgctttgttttgtacatgggcagccgccaggccactggggac
tacatgggggtgtctctgcgcaatcagaaggtgcactgggtgtacaggctaggcaaagct
ggccctacaactctcagcattgatgagaacattggggagcagtttgcagccgtcagcatt
gacaggaccctccagtttggccacatgtctgtcacagtggagaagcagatggttcatgag
atcaagggggacacagtggcccctgggatggaggggctactcagcctacaacctgacgac
tttgtcttctatgtgggaggataccccagcaacttcacgcctcctgagcccctccgattc
cctggctacctgggctgcattgagatggacaccctgaacgaggaggtggttagtctgtac
aattttaagcagaccttcaagctggacaccgcggtggataagccttgtgctcgctccaag
gccaccggtgacccgtggctcacggatggttcctacctggatggcagtggctttgcccgt
atcacctttgaaaagcagttcagcaacacaaagcgctttgaacaggagctgcggcttgtg
tcctacaacgggatcatctttttccttaagcaagagagccagttcctgtgcctggcagtg
caggagggcacccttgtcctcttttatgactttggctctggcctgaagaaggctgaacca
ctgcagcccccacaagccttgacagcagccagcaaggcgatccaggtgtttctactggct
accaatcgcaaacgtgtgctagtacgtgtggagagggccaccgtgttcagtgtggatcag
gacaacatgctggagatggctgatgcctactacctgggaggtgtgccacctgagcagctg
cccccgagcctacggcagctcttcccctcgggaggctctatccgcggctgcatcaaaggc
atcaaggctctgggcaagtatgtggaccttaaacgactgaataccacgggtatcagcttc
ggctgcaccgctgacctgctagtgggacgtaccatgactttccacggccacggcttcctg
cccctggcacttcccgatgtggcacccatcactggcgaggtctactccggctttggcttt
cgtggcatccaggacaacagcctgctgtactaccgcacttccccggatgggccatacatg
gtatccctgaagcaaggccatgtgacactccagtttatgagaacagaggtggaaactcaa
ggggcctttgctgatggagccccccattatgttgccttctacagcaatgctacaggggta
tggctatatgtggatgaccagctacaacagacaaagtcccaccagggaacattccccatg
ctccaactacagcctgaggaacccccacaacttctcctgggaggcctgcctatgtctggt
acctttcacaacttcagtggctgcattagcaatgtttttgtgcaacgacttcgggggcca
cagcgtgtgtttgacctacagcagaacacgggcagtgtcaacgtgagcataggctgcaca
ccagcccaactcgtccagacctcaagggcgacagtgcaaaaggtctcccgccgcagtcgc
caacccagccaggatcttgcttgcccaacaccctggctccttgggactattcagggtgca
taccagtttggaggaccccagcccagttacctacagtttgtggatgtctccccatcccac
aggaataggctccacttctcaatgctcgtccgcccacaagctgcttcccagggcctcttg
ctctctgcagcccccatgtcgagccacagcccttcgctgttactctttctgagccatgga
cacttcgttgcacagactgagggccctgggccccggctccaggtccagagccgccagcac
tcgcgggctggccagtggcacagggtgtctgtgcgctggggaacgcagcgggtccaactt
gtggtggacggcagccagacctggagccagaaggcactccaccactgggtccacagggca
gagagtccacagccctacacgctctttgtaggaggtctccctgccagtagttacagctcc
aagcttcccgtgtctgtggggttcaatggctgtatgaagaagctgcagctggataagcgg
cccctgagggccccaacgcgaatggtgggggtcacgccctgtgtctcaggccccctggag
gatggcctgttcttcccaggcagtgagggcattgtcacattagagttccccaaggccaag
ctgtcctatgtaagcctagagctagaggtacggcccttagcagctgctggcctcatcttc
catctgggccagacgcaggccacttcctatgtgcagctgcaggtgctgacagaacaggtt
ctacttcgggcaaatgatggggcaggagagtttgccacatgggtgacctaccccaagctt
tgtgatggacagtggcacagagtggcagtgaccaagggcaggaactcactccagctggag
gtagacatggagagcaaccacaccacaggccctttaccagcgaccttggctgattctcca
gcacttctgcaccttgggggcctgcccaaggcaagaactgctcagtcagagacccctgcc
tatcgaggatgcatgaggaagctggtgcttgatggggcccctatcaccatgatggcttct
gcacaaatccagggggcagtggggatgagtggctgcccctctggaaccgtagtcccagac
ccagctcactcttcagcaccttccaagcagggaaaagcactgacccagaggcaggtgggg
tccagtaggctttggaagatcaagcccagtgaacttccactacttcagcagcgctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110558987
Entry
110558987         CDS       T05884                                 

Gene name
Lamb1
Definition
(RefSeq) laminin subunit beta-1 isoform X1
  KO
K05636  laminin, beta 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110558987 (Lamb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110558987 (Lamb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110558987 (Lamb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110558987 (Lamb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110558987 (Lamb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110558987 (Lamb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110558987 (Lamb1)
   05145 Toxoplasmosis
    110558987 (Lamb1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C CorA HU-CCDC81_bac_2
Other DBs
NCBI-GeneID: 110558987
NCBI-ProteinID: XP_021509871
LinkDB
Position
Unknown
AA seq 1827 aa
MEGPLSSLSTFAFLPLYLSRKEDTKKRQAARPRRPPSRLQGPGMGLLQVFGVLALCATQV
CAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHRPEPYCIVSHLQEDKKCFIC
NSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMT
FKTFRPAAMLIERSSDFGQTWGVYRYFAYDCESSFPGVSTGPMKKVDDIICDSRYSDIEP
STEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYY
YAVYDMVVRGNCFCYGHASECAPVDGIDEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDL
PWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVTGGVCDDCQHNTMGRNCEQCKP
FYYQHPERDIRDPNLCEPCTCDPAGSENGGICDSYTDFSVGLIAGQCRCKLHVEGERCDV
CKEGFYDLSADDPFGCKSCACNPLGTIPGGSPCDSETGYCYCKRLVTGQRCDQCLPQHWG
LSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNEVESGYYFTTLDHYIYEA
EEAGLGPGVTVVERQYIQDRIPSWTGPGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQ
LPDHWEKAVITVQRPGKIPTSSRCGNTVPDDDNQVVSLSPGSRYVVLPRPVCFEKGMNYT
VRLELPQYTASGSDVESPYTLIDSLVLMPYCKSLDIFSVGGSGDGEVTNSAWETFQRYRC
LENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVV
GRTCDRCAPGTFGFGPNGCKPCDCHLQGSVSAFCDTVTGQCHCFPGIYARQCDRCLPGYW
GFPSCQPCQCNGHAEDCDSVTGECLSCLDYTTGHNCERCLAGYYGDPVIGSGDHCRPCPC
PDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDSCASGFFGNPSDFGGSCQPCQCH
DNIDTTDPDACDKETGRCLKCLYHTEGDHCQFCQHGYYGDALQQDCRKCVCNYLGTVKEH
CNGSDCHCDKATGQCSCLPNVVGQNCDRCAPNTWQLASGTGCEPCGCNAVHSFGPACNEF
TGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIETPQCDQATGQCVCVEGVEG
PRCDKCTRGYSGVFPDCTPCHQCFALWDAIISELTNRTHKFLEKAKALKISGVIGPYRET
VDSVEKKVSEIKDILAQNPAAEPLKNIGILFEEAEKLTKDVIEKMAQVEGKLSDTALQSN
STAGELDALQAEAESLDKTVKELAEQLEFIKNSDIQGALDSITKYFQVSLEAEKRVNAST
TDPNSTVEQSALTRERVEDLMLERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCG
TPPGADCSESECGGPNCRTDAGEKKCGGPGCGGLVTVAHSAWQKAMDFDRDVLSALAEVE
QLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDLRNLIKQIRNFLTEDSADLD
SIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQQSAADIARAELLLEEAK
RASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEE
TLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYTVKQSADDVKKTLDGELDEKYK
KVESLIAQKTEESADARRKAEMLQNEAKTLLAQANSKLQLLEDLERKYEDNQKYLEDKAQ
ELVRLEGEVRSLLKDISEKVAVYSTCL
NT seq 5484 nt   +upstreamnt  +downstreamnt
atggaagggcccctctcctctctctcaacatttgcctttcttcccctctacctctcgaga
aaggaagacacgaagaaaaggcaggcggctcgcccgcggcgtcctccttctcggctgcag
ggacccggcatggggctgctccaggtgttcggtgtcctagccctgtgtgctacccaagtg
tgcgctcaggaaccagagttcagctatggctgcgccgaaggcagctgctaccctgccact
ggcgaccttctcatcggccgagctcaaaagctctcagtgacctcgacctgcggactgcac
agaccagagccctactgtatcgtcagccacctgcaggaggacaagaaatgcttcatctgt
aattcccaagacccgtatcatgagaccctcaatcctgacagccatctcattgagaatgtg
gtcacgacatttgctcccaaccgccttaagatttggtggcaatccgaaaacggtgtggag
aatgtgaccatccagctggatttggaggcagagttccatttcactcacctcatcatgact
ttcaagacattccgtccggcagccatgctgatagagcggtcttcggacttcgggcagact
tggggtgtatacaggtacttcgcctatgactgtgagagctcgttccccggcgtttcaact
ggccccatgaagaaggtggatgacatcatctgtgactctcggtattctgacattgaaccc
tcaacggaaggagaggtgatatttcgtgctttagatcctgctttcaaaatagaggatcca
tatagcccaaggatacagaatctattaaaaatcaccaacttgaggatcaagtttgtgaag
ctgcacacgttgggagataaccttctggactctcgaatggaaatccgagagaagtactac
tacgccgtttacgacatggtggttcgggggaactgcttctgctacggccatgccagcgag
tgtgcccccgtggacgggattgatgaagaggtggaaggaatggttcacgggcactgcatg
tgcaggcacaacaccaaaggcttgaactgtgagctctgcatggatttctaccatgatttg
ccgtggagacctgcagaaggtcggaacagcaatgcctgcaaaaagtgtaactgcaacgag
cattccagctcatgtcactttgacatggcggtcttcctggccaccgggaacgtcactggg
ggagtgtgtgatgactgtcaacacaacaccatgggccggaactgcgagcagtgcaagccg
ttctactaccagcatcccgagagggacatccgggaccccaatctctgtgaaccatgtacc
tgtgacccagccggttctgagaacggaggcatctgtgacagttacacagacttttctgtg
ggtctcattgccggtcagtgtcggtgcaaattgcacgtggaaggagagcgctgtgacgtt
tgcaaagaaggcttctatgacttaagtgccgacgacccatttggctgtaaatcgtgtgct
tgcaatcctctgggaacaattcctggtgggagtccttgtgattctgagaccggttactgc
tactgtaagagactggtgacaggacaacgctgtgaccaatgtctgccgcagcactggggc
ttaagcaatgatctggatggatgtcgaccctgtgactgtgacctgggaggagcattgaac
aatagctgctccgaggactccggccagtgctcctgcctgcctcacatgatcgggcggcag
tgcaatgaggtggaatccggttactacttcaccaccctggaccactacatatacgaagcg
gaggaggctggcctggggcctggagtcaccgtggtggaacggcagtacattcaggaccgg
attccttcctggacaggacctggctttgtccgagtgcctgagggggcttatttggagttt
ttcattgacaacataccatattccatggagtatgacatcctaattcgctatgagccgcag
ctgccggaccactgggagaaagctgtcatcaccgtacagcgacctgggaagattccaacc
agcagccggtgcggtaacactgttcctgatgatgacaaccaggtggtgtccttgtcgccg
ggctcaagatacgtcgtcctgcctcgcccagtgtgctttgagaagggaatgaactacacg
gtgaggttggagctgcctcagtacacggcatccggcagtgatgtggagagcccctacacg
ctcattgactcgcttgttcttatgccctactgtaaatccctggacatcttctctgttgga
ggctcaggagacggggaggtcaccaacagtgcctgggaaaccttccagaggtaccggtgc
ctggagaacagccggagcgtagtaaaaacaccgatgacggatgtctgcaggaacatcatc
ttcagcatttctgccttgattcaccagacaggccttgcttgtgaatgcgaccctcagggt
tccctgagttctgtgtgtgatcccaatggaggccagtgtcagtgccgacctaatgtggtt
gggagaacctgcgacaggtgtgcgccaggcacctttggcttcggccccaacggatgcaaa
ccttgtgactgccacctacaaggatctgtcagtgccttctgtgacacggtcactggccaa
tgccactgtttccccggcatctatgctcggcagtgtgaccgctgtctccctggatattgg
ggctttcccagctgccagccctgccagtgtaacggtcacgccgaagactgtgactcggtg
acaggggagtgtctgagctgcctggactataccacaggccacaactgtgaaaggtgcctg
gctggttattatggtgaccccgtcatagggtcaggagaccactgtcgcccttgcccttgc
ccggacggtcctgacagtggacgccagtttgccaggagctgttatcaagaccccgttact
ctccagcttgcctgtgtttgtgatcctgggtatattggttccagatgtgacagctgtgcc
tcggggttcttcggcaacccctcagacttcgggggctcgtgccagccatgtcagtgtcac
gacaacattgacacgaccgatccggacgcctgtgacaaggagactgggaggtgcctcaag
tgcctgtaccacacagaaggggatcactgccagttctgccagcatggatactacggggat
gcccttcagcaagactgtagaaagtgtgtctgcaattacctgggcactgtgaaggagcac
tgcaatggctctgactgccattgtgacaaagccaccggccagtgctcatgtcttccgaat
gtcgtcgggcagaactgcgatcggtgtgcgcccaacacctggcagctggccagcgggacc
ggctgtgagccgtgtggctgcaatgctgtgcactcctttgggccagcctgcaatgagttc
accgggcagtgccagtgcatgccgggcttcggaggccgtacctgcagcgagtgccaggaa
ctcttctggggagaccccgacgtggaatgccgagcctgtgactgcgaccccaggggcatt
gagacaccgcagtgtgaccaggccacgggccagtgtgtctgtgtggagggtgtcgagggt
ccacgctgtgacaaatgcaccagagggtactcgggggtcttccctgactgtacaccctgt
caccagtgctttgccctctgggatgcgatcatcagtgagctgactaacaggacccacaaa
ttcctggagaaagccaaggctttgaaaatcagtggtgtgattggcccctaccgagagact
gtggactctgtggagaagaaagtcagtgagataaaagacatcctggcccagaaccccgca
gcagaaccgctgaaaaacatcggcattctctttgaggaagcagagaaattaaccaaagat
gtcatagaaaagatggcccaagtagaagggaaactgtctgacacagctttacagagtaac
agcaccgctggagagctagatgcactgcaggcggaagcagagagcctggacaagactgtg
aaagaactggctgaacagcttgaatttatcaaaaactctgatattcagggtgccttggat
agcatcaccaagtatttccaggtctctcttgaggcagagaagagggtgaatgcttccaca
acagaccccaacagcaccgtggagcagtcggccctcacccgagaaagggtagaagatctg
atgttggaacgagagtcccagttcaaagaaaagcaagaggaacaggcacgccttctggat
gaactggccggcaaactgcaaagtctagacctgtcagctgctgctgagatgacctgtggc
acgcctccaggagctgactgttctgaaagtgaatgtggtggcccaaactgtagaactgat
gctggagagaagaagtgtgggggccctggctgtggtggtcttgtcactgtggcccacagt
gcctggcagaaagccatggattttgaccgtgatgtcctgagtgccctggctgaagtagaa
cagctctctaagatggtttctgaagcaaaagtgagagcagatgaagctaagcagaatgct
caggatgtcctgttgaaaacaaatgctaccaaagaaaaagtggacaagagcaatgaagac
ctaaggaacctcatcaagcagatcagaaactttctgactgaggatagtgctgatctggac
agtattgaagcagttgctaacgaggtactgaaaatggaaatgcctagcaccccacagcag
ttacagaacctcacagaagacatccgggaacgagtggaatccctttctcaagtagaggtt
attttgcagcagagtgctgctgacattgccagagctgagctgttgctggaagaagccaag
agagcaagcaaaagtgcaacagatgttaaagtcactgcagacatggtaaaggaagcatta
gaagaagcagaaaaggcccaggttgcagcagagaaggcgattaaacaagctgatgaggat
attcaaggaacccaaaacctgctaacgtcgattgaatctgaaacggcagcttctgaggaa
accctaaccaatgcttcccaacgcatcagcaagcttgagaggaatgtagaagagcttaag
cgtaaagctgcccagaactctggagaggcagaatatattgaaaaagtagtatatactgta
aaacagagtgcagacgatgttaagaagactctagatggtgaactcgatgaaaagtataag
aaggtagaaagtttaattgcccaaaaaacagaagagtcagcagatgccaggaggaaagcc
gagatgctacaaaatgaagcaaaaacactcctggctcaagccaacagcaagctccaactg
ctggaagacttagaaaggaaatatgaggacaatcaaaaatacttagaagataaagctcaa
gaattagtacgattggaaggagaagtccgttcactccttaaggacataagcgagaaagtt
gctgtttatagcacctgcttataa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110559223
Entry
110559223         CDS       T05884                                 

Gene name
Lama2
Definition
(RefSeq) laminin subunit alpha-2
  KO
K05637  laminin, alpha 1/2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
mun05410  Hypertrophic cardiomyopathy
mun05412  Arrhythmogenic right ventricular cardiomyopathy
mun05414  Dilated cardiomyopathy
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110559223 (Lama2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110559223 (Lama2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110559223 (Lama2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110559223 (Lama2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110559223 (Lama2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110559223 (Lama2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110559223 (Lama2)
   05414 Dilated cardiomyopathy
    110559223 (Lama2)
   05416 Viral myocarditis
    110559223 (Lama2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110559223 (Lama2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110559223 (Lama2)
   05145 Toxoplasmosis
    110559223 (Lama2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_I Laminin_B Laminin_N DUF948 Ribosomal_S15
Other DBs
NCBI-GeneID: 110559223
NCBI-ProteinID: XP_021510224
LinkDB
Position
Unknown
AA seq 1903 aa
MYCKLVEHVPGQPVRNPQCRICNQNSSHPYQRHPITNAIDGKNTWWQSPSIKNGVEYHYV
TITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDNVEYKPWQYHAVTDTECLTLYNIYP
RTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRLR
FQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATNK
SRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDENVARRNL
SLNIHGKYIGGGVCINCTQNTAGINCETCIDGFFRPKGVSPHYPRPCQPCHCDPVGSLSE
ICVKDEKYARRGLKPGSCHCKTGFGGLNCDRCVRGYSGYPDCQPCNCSGSGSTNEDPCVG
PCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSTRCQSSYWTYGNVQEMHGWY
LTDISGRVQVAPQLDHPDSPQQISISNFQARRSLPEAYYWRAPAPYLGNKLSAVGGQLSF
TISYDLEEEEDDLKNTLQLMIILEGNNLRISTAYKEVYLEPSEEHTEEISLKEESFTIHG
TNLPVSRKDFMTVLANLERVLMQITYNLGMDAIFRLSSVNLESAVPHPTDRRVAAAVEVC
QCPPGYSGSSCESCWPRHRRVNSTVFGGICEPCRCFGHADSCDDVTGECLNCKDHTGGPR
CSECLPGFYGDPTRGSSEDCQPCACPLSIPSNTFSPTCHLDRSLGLICDECPAGYTGPRC
ERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRFCELCADG
YFGDAVGAKNCQPCRCNTNGSSSEICHTRTGQCECKANVQGKRCDECKPETFGLQLGRGC
IPCNCNSFGSKSFDCEESGQCWCQPGVAGKKCDRCAHGYFNFQEGGCTACDCAHLGNNCD
PKTGQCICPPNTIGEKCSECVPNTWGHSIMTGCKACNCSTVGSLAPQCDVSTGQCNCHPK
FSGMTCSECNRGHWNYPLCSLCDCSLPGTEASTCDSDTRKCSCADQTGQCTCKVNVEGIR
CDRCRPGKFGLDAKNPLGCSSCYCFGVTTQCSEAKGLVHTRVTLSNEQTILPLVDEALQH
TTTKGIAFQHPETVAKMDEVRQELHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEARDE
TGFSTYKPQVIIRGGTPTHARIITRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTV
TREDFMDVVYDIHYILIKATYGNVVRQSRISEISMEVAEPGHVTAASPPARLIERCDCPP
GYSGLSCETCAAGFYRLRSEPGGRTPGPSLGSCVPCQCNGHSSRCDPETSVCQNCQHHTA
GDFCERCALGYYGIVRGLANDCQPCACPLVSPSNNFSPSCVLEGVDDYRCTACPRGYEGQ
YCERCAPGYTGSPTSPGGSCQECECDPYGSLPVPCDPVTGLCTCRPGATGRKCDGCEHEH
AREGTECVFCGDECTGLLLGDLARLEQMAMDINLTGPLPAPYKILYGLENTTQELKHLLS
PQRAPERLIQLAEGNLNTLAMEMNELLTRATKVTADGEQTGQDAERTNTRAKSLEEFIKE
LLQDAEAVNEKAVKLNETLGSQDRTAERNLQELQKEIDRMLKELRSKDLQTQKEVAEDEL
VAAEGLLKRVNKLFGEPRAQNEELEKDLQEKLAGYKNKLDDARDLLREATEKTRDANHLS
AINQKNMTILEKKKEAIESGKQQIENTLKESNGILDEANRLADEINSVIDYVEDIKTKLP
PMSEELSDKIDDLSQEIKDRKLAEKVFQAESHAAQLNDSSAVLDGILDEAKNISFNATAA
FRAYSNIKDYIDEAEKVAREAKDLAQEATKLVRNRVSCAKNGS
NT seq 5712 nt   +upstreamnt  +downstreamnt
atgtactgcaagttggtggaacatgtccccgggcagcctgtgaggaaccctcagtgtcga
atctgcaatcaaaacagcagccatccataccaaagacacccaatcacgaatgctattgat
ggcaagaacacttggtggcagagtcccagtatcaagaatggagtcgaataccattatgtg
acaattacgctggatttacagcaggtgttccagattgcctatgtgattgtgaaagcagcc
aactcccctcgacctggaaactggattttggaacgttcactggataatgtggagtacaaa
ccttggcagtatcacgcagtgacagacacagagtgcctgaccctctacaatatctatccc
cgcactggaccaccatcctatgccaaggatgatgaggtcatctgcacttcattttattcc
aagatccaccctttagagaatggagagattcacatttctttgatcaatgggagaccaagt
gcggacgatccctcccctgagcttctggaattcacctctgctcgctatattcgcctgaga
ttccagcggatccgcaccttgaacgccgacttgatgatgtttgctcacaaagaccccaga
gaaatcgaccccattgtcacaagaagatattactactcagtcaaggatatttcagttggc
gggatgtgcatctgttatggtcatgcccgggcttgtccgcttgatcctgcaacaaataaa
tcacgctgcgagtgtgagcataacacctgtggtgagagctgtgacaggtgctgtcccgga
ttccatcagaagccctggagagctgggacattcctgaccaagtctgagtgcgaagcatgc
aattgtcatggaaaagctgaagagtgctattatgatgaaaatgttgccagaagaaatctg
agtttaaatatacatgggaagtacatcggagggggtgtttgcatcaactgcacacagaac
acagctgggataaattgtgagacgtgtattgatggattcttcagaccaaaaggggtgtcg
ccgcattacccaagaccgtgccagccatgtcactgtgatccagttggctccttgagtgaa
atctgtgtcaaggatgagaaatatgcccggcgagggttgaaacctggatcttgtcactgc
aaaactggctttggaggtttgaactgcgatcgatgtgtccggggctacagcggctaccca
gactgccagccctgtaactgcagtggctcagggagcacaaacgaggacccttgtgttggg
ccctgtagctgtaaggagaacgttgagggtgaagactgcagccgttgcaaatctggcttc
ttcaacttgcaagaggataatcagaaaggctgtgaggaatgcttctgttcaggggtgtcg
accagatgtcagagttcctactggacctacgggaatgttcaagaaatgcacggttggtat
ctcacagacatctctggccgcgttcaggtggctcctcagcttgatcaccccgactcccct
cagcagatcagcatcagcaacttccaggcccggcgctccctcccagaggcttactactgg
cgtgcgccagccccgtatctgggaaacaaactctcagctgtaggaggacaattgtcattt
accatctcatatgacctcgaagaagaggaggacgatctaaaaaacacccttcagctgatg
attatcttagagggaaataacttgaggatcagtacagcctataaggaggtgtatttagaa
ccatctgaagaacacactgaggagatatcactcaaagaagagtcctttaccatacatgga
acaaatttaccagtcagtagaaaagattttatgaccgtgcttgcaaatttggagagagtc
ctcatgcaaatcacatacaacttagggatggatgccatcttcagattgagctccgtcaac
ctcgaatctgccgtcccccaccctacagacagacgcgttgcagctgctgtggaagtttgc
cagtgtccacccgggtacagtggcagttcttgtgaatcgtgttggcctaggcaccgaaga
gttaacagcactgttttcggtggcatctgtgaaccatgtcggtgttttggtcacgcagac
tcctgtgatgatgtcacgggagagtgtctgaactgtaaggatcacacaggtggtccacgc
tgcagtgaatgtcttcctggtttctatggcgaccccactcgagggagctctgaagactgt
caaccctgtgcttgcccactcagcatcccatccaatacctttagcccaacgtgccattta
gaccggagtctgggattgatctgtgatgaatgtcctgcagggtacacaggaccacgctgt
gagaggtgtgcagaaggctatttcggacaaccttccgtacctggaggatcatgtcagcca
tgccagtgcaatgacaaccttgacttctccatccctggcagctgtgacagcttgtctggc
tcctgtctgatatgtaagccaggtacaacaggccggttctgtgagctctgtgctgatggg
tattttggagatgcggttggtgcaaagaactgtcaaccctgccgctgtaacaccaatggc
tcctcctcagagatatgtcacactagaacgggacagtgtgaatgcaaagccaatgttcag
gggaagcgctgtgatgagtgtaagcctgaaaccttcggcctgcaattgggaaggggctgt
attccgtgcaactgcaactctttcgggtctaaatcgtttgactgtgaagagagtggacag
tgctggtgccagcctggagtagcggggaagaaatgtgaccgctgtgctcacggctacttc
aacttccaagaaggaggatgcacagcttgtgactgtgcccatctgggcaacaattgtgac
ccaaagactggtcaatgcatttgccctcctaataccattggagaaaaatgttctgagtgt
gttcccaacacctggggccacagcatcatgacgggctgtaaggcttgtaactgcagcacc
gtgggttccctggctccgcagtgtgatgtaagcacgggccagtgcaactgtcatccaaaa
ttctctggtatgacatgctcagaatgcaaccgaggtcactggaactatccgctctgcagt
ctctgcgactgctctcttccagggacagaggcctcaacttgcgattcagacaccaggaag
tgctcctgtgccgaccagactggacagtgcacctgcaaggtgaatgtggaaggcatccgc
tgtgacaggtgccggcctggcaaattcggacttgatgccaagaacccacttggctgcagc
agctgctattgctttggagtcaccactcagtgctctgaagcaaaggggctggtccatacg
cgggtgactctgagcaatgagcagaccatcctgcctctggtagacgaagccctgcagcac
acaaccaccaagggcattgctttccagcacccggagactgtggcaaagatggacgaagtc
aggcaagagctccatttggagcctttttactggaaactcccagaacaatttgaagggaaa
aagttgatggcctatgggggtaaactcaagtatgccatctattttgaggctcgggatgag
acaggcttctccacatacaaaccccaagttatcattcgaggcgggactcctactcacgct
agaattatcaccaggcacatggctgcccctctcattggccagctgacaaggcatgaaatt
gaaatgacagagaaagaatggaaatactacggtgatgatccccgaatcagcagaacggtg
actcgtgaagacttcatggatgttgtatatgatatccactacatccttatcaaggccact
tatggaaatgttgtgaggcaaagccgcatttctgaaatctccatggaagtagctgaacca
ggacatgtgacggccgcaagcccaccagcacgcttgatagaaagatgtgactgcccccct
ggctattctggcttgtcctgtgagacatgtgcagcaggattttacagactgcggtcggaa
ccaggcggccgcacccctggaccaagcctgggaagctgtgttccctgtcagtgtaacgga
cacagcagccggtgtgatcctgagacctcagtctgccagaattgtcagcatcacacggct
ggtgatttctgtgagcgatgtgcccttggctactatggaattgtcaggggattggcaaat
gactgtcaaccgtgtgcatgtccgctggtttctcccagcaacaatttcagcccctcctgt
gtactggaaggtgtggacgattaccgctgtacagcctgcccccgaggatatgaaggacag
tactgtgaaaggtgtgcgccaggctacactggaagtccaaccagccctggaggctcctgc
caagaatgtgagtgtgacccttacggctccctgcctgttccctgtgacccggtcacggga
ctctgcacgtgccgccctggagccacaggaaggaagtgtgatggctgcgagcacgagcat
gcacgcgagggcacggagtgtgtcttttgtggagacgagtgcacaggccttcttctcgga
gacctggctcgcctggagcagatggccatggacatcaacctcaccggcccgctgcctgct
ccgtataagattctgtatggtcttgaaaatacaactcaggaactcaagcacctgctctca
ccccagcgggcaccggagaggctcattcagttggcagagggcaatctgaacacgctcgcg
atggaaatgaatgagctcctgaccagagcgaccaaagtgacagcagatggcgagcaaaca
ggacaagatgccgagaggaccaacacaagagcaaaatccttagaagaattcattaaagag
cttctccaggatgcagaagccgtaaatgagaaagccgtaaaactaaatgaaacattagga
agtcaagacaggactgcagaaagaaacttgcaagagcttcagaaggaaattgatcggatg
ctgaaggaactcagaagtaaagatcttcagacacagaaggaagttgccgaggatgagctg
gtggcagcagaaggccttctgaagcgggtgaacaagctgtttggagagcccagagctcaa
aatgaagaactggaaaaggatctccaggagaaactggcaggttataagaacaaactcgat
gatgctcgggatctactgagagaagccacagagaaaacacgagatgctaatcacctgtct
gctatcaaccaaaaaaacatgaccattttggagaaaaagaaggaggctattgaaagtggc
aaacagcaaatagagaacactctgaaggagagcaatggcatacttgatgaagccaaccga
ctagcagatgaaatcaactctgtcatagattacgtcgaagacattaaaaccaagttgcca
ccaatgtccgaggagcttagtgacaaaatagatgacctctcccaggaaataaaggacagg
aagcttgctgagaaggttttccaggctgagagtcacgcggctcagctgaacgattcgtct
gctgtgctggatggaatcctggatgaggctaagaacatctctttcaatgccactgcagcc
ttcagagcttacagtaatattaaggactatatcgatgaagctgagaaagttgccagagaa
gcaaaagatcttgcccaggaagctacaaaactggtaagaaacagagtatcatgtgctaag
aatggaagctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110559252
Entry
110559252         CDS       T05884                                 

Gene name
Lamc3
Definition
(RefSeq) laminin subunit gamma-3 isoform X1
  KO
K06247  laminin, gamma 3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110559252 (Lamc3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110559252 (Lamc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110559252 (Lamc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110559252 (Lamc3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110559252 (Lamc3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110559252 (Lamc3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110559252 (Lamc3)
   05145 Toxoplasmosis
    110559252 (Lamc3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B Thioredoxin_3
Other DBs
NCBI-GeneID: 110559252
NCBI-ProteinID: XP_021510305
LinkDB
Position
Unknown
AA seq 1602 aa
MAASGVLSRPAGVASVALVALVALGALGAHCAAGVGMGSCYDGAGRAQRCLPEFENAAFG
RRAEASHTCGRPPEDYCPHVGVPGAGPQCQRCDDADPRRRHDASYLTDFHSPDDSTWWQS
PSMAFGVQYPTSVNLTLRLGKAYEITYVRLKFHTSRPESFAIYKRTRTGGPWEPYQYYSA
SCQKTYGRPEGHYLQPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVL
QEWVTSTDLLISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECSPNEA
GQLACHCQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELFRS
TGHGGHCRHCRDHTAGPHCERCEGSYYRWSTRMPCQPCDCHPAGSVSLQCDHSGTCTCKP
TVTGWKCDLCLPGFHSLSEGGCRPCTCNVAGSLGPCDPRSGHCPCKENVEGSLCDRCRPG
TFNLQPHNPAGCSSCFCYGHSKVCAPAAGFQAHHILSDFHHGADGWRVRSTEVSERPLQW
NRSGILLGPEGEEELLAPEKFLGDQRLSYGQPVVLTLQVPPGASPPPVQLRLEGAGLTAA
LRPSRPPSPQDTRQPGQVQLWFLLQETSEDTEPPLPTFHFQRLLASLTALRIRTSGQGPG
HAGPVFLYEVWLTSARPQRGLAPPAPWVEACLCPQGYTGQFCEFCAPGYKRETPLGGPYT
SCVPCTCNHHGTCDPSTGICLCGHHTEGPSCERCMPGFYGNAFSGHADDCQPCPCPGQSA
CTTIPDSGEVVCTHCPAGQRGRRCENCEDGFFGDPLGLSGTPQPCRRCRCSGNVDLNAVG
NCDPHSGHCLRCLYNTTGAHCEHCQEGFYGSALATRPADKCAPCSCDLRGSVRGKTSCDQ
GTGQCACLPHVTGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPQTGQCPCRPGV
TGQACDRCQLGFFGFSIKGCRDCRCSPLGSASSQCRENSTCVCRPGFMGYKCDRCQDNFF
LVDGGTGCQECPTCYALVKEAAAKLKARLMGMEGWLQGSDCGSPWGPLDILQGEAPRGAV
YQGHHRYQEAWGPFLEQMAGLEGAVKAVREQVQVLRGRAHCAQAEAQKTCVQMSELGETL
QSSEEEVLRAASALSFLEEPRFLPLFFKASFQEGSIPPTNWSHLASEAHVLARSHRDTAT
KIAATAQRALLASNASRELLWNLLKGRVASEVQQDLEDRYQEVQAAQTALGTAVAELLPK
AQRALATSKHDIGDMASRLVPLVTPGAMPQNSQAKDLYRRVKALEQKLEQKEREAGQAIG
ALQVEAGRALRKMEPFVQLRYETTAALTQASSAVHAATVTVIGAKTLLADLEGMKLRFPL
PKEQAALKRKAGTIRTRLLEETKRKTKQAERMLGNAASLSSSAKKKSKEAELMSKDNAKL
ARALLREGKQGYRHASRLASQTQATLRQASRLVLTSEARRRELEEAGQVASGLSTVEHQI
RESRVSLEKDTKVLSELLAKLGSLGVHQASAQTLNETQQALESLRLQLGSRGALHRKLRR
LEEESARQELQIQSFESDLAEIRADKHNLETILSSLPEHCAS
NT seq 4809 nt   +upstreamnt  +downstreamnt
atggccgcgtcaggggtcctgtcgcgcccggcaggagtggcatcggtggcgctggtggct
ctggtggcgctgggggcgctgggggcgcactgcgcggcgggcgtgggcatgggctcttgc
tacgacggcgcgggacgcgcacagcgctgtctgccggagttcgagaacgccgcgttcggc
cgacgcgccgaggcctcgcacacgtgcggacggccccccgaggactactgtccgcacgtc
ggggtgcccggcgcggggccccagtgccagcgctgcgatgatgccgacccccggcgacgc
cacgacgcctcctacctcacagacttccacagccctgatgacagcacctggtggcagagc
ccatccatggcctttggggtgcagtaccccacctcagttaaccttaccctgcgcctaggg
aaagcctatgagatcacctacgtgaggctgaagttccataccagccgccccgagagcttt
gccatctacaaacgcacacgcaccgggggcccctgggagccctaccagtactacagcgcc
tcctgccagaaaacctacggccgccctgaggggcactacctgcagccgggtgaggacgag
agggtggctttctgcacctctgagttcagcgacatctcccccctgaacgggggcaacgtg
gccttctccaccctggagggccgtcccagtgcctacaactttgaggagagccctgtgcta
caggagtgggtcaccagcaccgacctcctgatctctctggaccggcttaacacgtttggg
gatgacatcttcaaggaccccagggtcctccagtcttactactatgctgtgtctgacttc
tccgtgggcggcaggtgcaaatgcaacggtcacgccagtgagtgcagccccaacgaggct
ggtcagctggcctgccactgccagcacaacaccacgggtgtggactgcgagcgttgtcta
cccttcttccaggaccgtccctgggcccggggcaccgcagaggatgccaacgagtgtctg
ccctgcaactgcagtggccactctgaggagtgcacgtttgacagggagctcttccggagc
acgggccacggcgggcactgtcgccactgccgtgaccacaccgccgggccgcactgtgag
cgctgcgaggggagctattacagatggagcacgaggatgccgtgccaaccctgtgactgc
cacccagcaggctccgtgagtctgcagtgtgaccactcgggcacctgtacctgcaagccc
acggtgacgggttggaagtgtgacctctgcctgcctgggttccactcactcagcgagggg
ggctgcagaccctgtacctgcaatgtcgctggcagcttgggcccctgtgacccccgcagt
gggcactgtccctgcaaagagaacgtggaaggcagcctgtgtgacagatgccgccctggg
acctttaacctgcagccccacaacccagccggctgcagcagctgcttctgttacggccac
tccaaggtgtgcgcccctgctgccgggttccaggcacaccacatcctctcagacttccac
catggagctgatggctggcgggtcagaagcacggaggtgtcagagcgtcctctgcagtgg
aaccggagtgggatccttctgggcccggaaggagaggaggaactcttggcaccagagaag
ttcctgggagaccagaggctcagctatggacagccagtcgtactgaccctccaagtgccc
cctggggcctccccacctcctgtgcagctgaggctggagggggcaggtttgaccgcggct
ctgaggccctccaggccacccagccctcaggacaccaggcagccaggacaagttcagctc
tggttcctcctgcaggagacctctgaggacacagagcccccgctgcccaccttccacttc
cagcgcctgcttgccagtctgactgctctgcgcatccggaccagcggccaaggcccgggt
catgctggcccagtgttcttgtacgaggtctggctcacgtcggcccggccccagagaggg
ctcgccccgccggccccttgggtggaggcctgcctgtgtccccagggatacacaggccag
ttctgcgaattctgtgctccgggatacaaaagagagacacctcttgggggtccctacacc
agctgcgtcccctgcacctgcaaccatcacggcacctgtgatcccagcacagggatctgc
ctgtgtggccaccacactgagggcccttcctgtgagcgctgcatgccaggtttctatgga
aacgccttctcaggccacgccgatgactgccaaccctgtccatgccccggccaatcagcc
tgcacaaccatcccagacagtggcgaggtggtgtgcactcactgtcccgctggtcagaga
ggacgacgctgtgagaactgtgaagatggcttttttggggatcctctcgggctctccgga
actccccagccctgccgccggtgccggtgcagcgggaacgtggatctcaatgctgtgggc
aactgtgatcctcattctggccactgcttgcgctgtctgtacaacacaacaggggcccac
tgcgagcactgccaggagggtttctacgggagtgccttggccacaaggcccgcggacaaa
tgtgctccctgcagctgcgacctgaggggttcagtccgtgggaagacgtcctgcgaccag
gggaccggccagtgtgcctgcctgcctcatgtcaccgggagggactgcagccgctgcagc
cccggcttctatgacctccagtctgggaggggctgccagagctgtaaatgtcacccactc
ggctccttggagaacaagtgccacccccagaccggccagtgcccctgccgacccggcgtc
acaggccaagcctgtgacagatgccagctgggtttctttggcttctccatcaagggctgc
cgggactgccggtgttccccactgggttctgcctcctcccagtgccgtgagaacagtaca
tgtgtgtgccggcccggcttcatgggctacaagtgtgaccgctgccaggacaatttcttc
ctcgtggatggtggcacgggctgccaagagtgtccaacctgctatgccctagtgaaggag
gcggcagccaagctgaaggccaggctgatggggatggaggggtggctgcaggggtctgac
tgcggcagcccctggggaccactggacatcctgcaaggagaagcccctcgaggggctgtc
taccaaggtcaccaccgataccaagaggcctgggggcccttcctggagcagatggcgggc
ctggagggtgccgtgaaggccgttcgggagcaggtgcaggtgctgagagggagggcccac
tgtgcgcaggctgaagctcagaagacctgcgtccagatgtcggagctgggggagacattg
cagtcctcagaggaggaggtcctgcgagcagcctcggctctttcctttctggaggagcct
cggtttcttcctctcttctttaaggcgagttttcaggaaggatccatcccacctacaaat
tggagccatctggcatcagaggcccacgtcctcgccaggagccacagggacacagccacc
aagatcgcagccactgcacagagggccctgcttgcctccaatgccagccgagagctcctg
tggaatctgctgaaggggagagtggcctcggaggtccagcaagatctggaagacaggtac
caggaagtgcaagcagctcagactgctctgggcacagctgtggcagagctgctgcccaaa
gctcagagggcactggccacctcgaaacacgatattggcgacatggcctcacgtctggtc
ccactggtcacccctggagcaatgcctcagaattcccaagccaaggacctgtaccggaga
gtgaaggccctggagcagaagctggagcagaaggagcgcgaggcaggccaggccatagga
gccttgcaggtggaggctgggagagccctgcggaagatggagcccttcgtgcagctacgc
tatgagaccacagctgccctgacacaggcttcctcagctgtccacgctgccacggtgaca
gtcataggagcgaagaccctgctagctgacctagagggcatgaagctgcggtttcctctg
cccaaggagcaggcagcgctgaagaggaaagcaggcaccatcaggactaggctcctggag
gaaacgaagaggaagaccaagcaggcagaaaggatgctgggaaatgctgcgtctctctcc
tccagtgccaagaagaaaagcaaagaagcagagctgatgtccaaggacaatgccaagctc
gccagagctctgctgagggaagggaagcaaggttaccgtcatgccagccgactcgccagc
cagacgcaggccacgctccgccaggcctctcgcctggttctgacctcagaagcacgcaga
cgggagctggaggaagctgggcaggtggcctctgggctgagcactgtggagcaccagatc
cgagagtctcgagtctccttggagaaggacaccaaggtcctgtcagagctgctggccaag
ctggggtccctgggtgtccaccaagcctccgctcagaccctgaacgagacccagcaggcg
ctagaaagcttgaggctgcagctgggttcccgaggggccctgcatcgcaaactgaggcgg
ctggaggaagagtctgcccggcaggagctgcagatccagagcttcgagagcgacctggcc
gagatccgagctgacaagcataacctggagactatcctaagcagcctacctgagcactgt
gccagctag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110559812
Entry
110559812         CDS       T05884                                 

Gene name
Lamb3
Definition
(RefSeq) laminin subunit beta-3
  KO
K06244  laminin, beta 3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110559812 (Lamb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110559812 (Lamb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110559812 (Lamb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110559812 (Lamb3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110559812 (Lamb3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110559812 (Lamb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110559812 (Lamb3)
   05145 Toxoplasmosis
    110559812 (Lamb3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF F5_F8_type_C Laminin_II Tropomyosin
Other DBs
NCBI-GeneID: 110559812
NCBI-ProteinID: XP_021511108
LinkDB
Position
Unknown
AA seq 1172 aa
MMIALLVLCLALPGLLCAQQACSQGACYPPVGDLLVGRTQHLRASSTCGLTKPEIYCTQY
GQWQMKCCKCDSRLPHNYNSHQVENVASSSGPMRWWQSQNDVSPVSLQLDLDKRMQLQDI
MMDFKGLMPAGMLIERSSDFGNTWRVYQYLATDCASTFPQVHQGQPKTWQDVRCRPLPQR
PNGHLTGGKVQLNLMDLASDIPASQSKKIQELGDITNLRVNFTKLAPVPQRGSYPPSAYF
AVSQLRLQGSCFCNGHADHCAPNPGGPRGPTTAVQVSDVCICQHNTAGPHCERCASFYNN
RPWGPAEGQNTHECQRCDCNGHSETCHFDPAVFAASRGTSGGVCDNCRDHTEGKNCQRCQ
LHYFRNRRPGAPIHETCIPCECDPDGAVPGAPCDPLTGQCVCKEHVQGERCDLCKPGFTG
LTLTNPQGCHRCDCSILGARRDMPCEEETGRCLCLPNVVGPKCDQCAPAHWKLASGRGCE
PCACDPRNSLSPQCNQFTGQCPCREGFGGLTCSSAAIRQCPDRTHGDVVTGCRGCDCDFR
GTEGPGCDKASGHCLCRLGLTGPRCDQCQRGYCDSYPVCVACHPCFQAYDVDLQEQARRL
GSLRNATDGLRTGPGSEDHGMASRLLDAKNKMEQIGQILGDSSVTEQDVAQVANAISSIR
RTLQGLPLDLPLQEEMESFSADLGNLDRSFNRLLLMYQSKKEQFEKLSSADPSGAFRMVT
SAYEQSSQAAQQVSDSSSLLSQLRDSRREVAGLERQAGGGGAGGAQLVTLRLEMASLPDL
TPTINKLCGGSRQTACTPGLCPGELCPQDNGTACGSHCRGALPRAKGAFRMAGQVAEQLR
GFNSQLQQTRQMIRAAEEAASRVQSDAQRLETQVSTSRLQMEEDVRRTRLLIQQVRAFLT
DPDTDAASIQEISEAVLALWLPTDSATVLRKMKEIQAIAARLPNVDLVLSQTKQDIARAR
RLQAEAEEARGRAQAVEGQVDDVIGNLRQGTVALQEAQDTMQGTGRSLRLIQERVAEVQQ
VLGPAERLVTGMKEQMSGFWAQMEELRRQAQEGQAQAMQAQRLAEGASQQALSAQEGFER
LKRKYRELKNRLGQSPALGEQGSRILSIKTEAEELFGETMGMMDRMKDMESELLRGSQAI
MLRSADLSGLEKRVEQIRSYINGRVLYYATCK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgatgatagcacttttagtcctgtgcttggccttgcctggcctcttgtgtgcccaacaa
gcctgctcccagggggcatgttatccacctgttggggacttgctcgttggaaggactcag
catctccgagcctcatctacctgcggtctgaccaagccagagatctactgcacccagtac
ggacagtggcagatgaaatgctgcaagtgtgactccaggctgcctcacaattacaacagc
caccaagtggagaacgtcgcctcgtcctcaggccccatgcgctggtggcagtcacagaac
gatgtgagccctgtgtctctgcagctggacctggacaagagaatgcagcttcaggacatc
atgatggacttcaagggtctcatgccggccggcatgttgattgaacgctcttctgacttt
ggcaatacctggagggtgtaccagtatctggccacagactgtgccagcacctttccccag
gtccaccagggccagcccaagacctggcaggacgttcggtgccggccgctgccgcagagg
cccaacgggcacctaacggggggaaaggtccaacttaaccttatggatttggcgtcagat
atccccgcatctcagagtaaaaagattcaagaattaggggacatcacaaacctgagagtc
aacttcaccaagctggcccctgtgcctcagaggggctcctacccacccagcgcctacttt
gcagtgtctcagctacgtctgcaggggagctgcttctgtaacggacatgccgaccactgt
gcccccaaccctggaggccctagaggtcccaccactgctgtgcaggtcagcgatgtctgc
atctgccagcacaacactgctggcccccactgtgagcgctgcgcctccttctacaacaac
cggccgtggggacctgcagagggccagaacacccacgagtgccaaaggtgtgactgcaac
gggcactcggagacctgccactttgaccccgctgtgtttgctgccagccgggggacaagc
gggggtgtgtgtgacaactgccgggaccacaccgagggcaagaactgccagcgctgtcag
cttcactatttccggaacaggcgacccggcgctcccattcacgagacctgtatcccctgc
gagtgtgacccagatggggcagtcccaggagctccctgtgacccattgactggccagtgt
gtgtgcaaagagcatgtgcaaggagagcgctgtgacctttgcaagcctggcttcaccgga
ctcaccctcaccaacccacagggctgccaccgttgtgactgcagcatcttgggtgcccgg
cgagatatgccttgtgaggaggaaactgggcgctgcttgtgtctgcccaatgtggtgggc
cccaaatgtgatcagtgcgcccctgcccactggaagctggccagtggccggggctgtgag
ccctgtgcctgtgaccctcgtaactccctcagcccccagtgtaaccagttcacaggccag
tgtccttgtcgggaagggtttggtggcctcacgtgcagctctgccgccatccgacagtgt
cccgaccggacccatggagacgtggtcacagggtgtcgaggctgtgactgcgacttcaga
ggaactgagggtcccggctgtgacaaagcctcaggccactgcctctgccgcctcggcttg
acgggcccccgctgtgaccagtgccagcgaggatactgtgacagctacccagtatgtgtg
gcctgtcacccttgtttccaggcctatgacgtggacctccaggagcaggctcggcgcctc
ggcagtcttcgtaatgccactgacggcctgcggacagggccaggttccgaggaccatggc
atggcctctcggttgctagatgccaagaacaagatggagcagattggacagatcctaggg
gacagctctgtcacagagcaggatgtagctcaggtggccaatgccatctcgtctatcagg
cggactcttcagggcctgccgctggacctgcccttacaggaggagatggagtccttctct
gcagacctggggaatctggacagaagcttcaaccgcctcctcctcatgtaccagagcaag
aaggagcaattcgagaagctaagcagtgctgacccttcaggtgccttccgcatggtgacc
tccgcttacgagcagtcctcccaggctgcgcagcaggtgtccgacagttccagcctgctg
agccagctgagggatagtcgcagggaggtggcagggctggagaggcaggctgggggagga
ggagctggaggagcccagcttgtgaccctgcgcctggagatggcctcactgcctgacctg
acacccaccatcaacaagctctgtggcggctctaggcagacagcctgtaccccaggactg
tgcccaggagagctgtgcccccaggacaatggcacagcctgcggatctcactgcagggga
gccctgcccagagccaaaggggccttccgcatggcagggcaggtagctgagcagctacgg
ggcttcaattcccagctccagcagaccaggcagatgatcagggcagccgaggaagcggca
tccagggtccagtcagacgcgcagcgcctggagacccaggtgagcaccagccgcctgcag
atggaggaagatgtccggcgcacgcggcttctcatccagcaggtccgggccttcctcacg
gaccctgacacagatgcggcctccatccaagagatcagtgaagcagtgctggctctctgg
ctgcccacagactcagccacagtgctgcgcaagatgaaagagatccaagctattgctgcc
aggctccccaatgtggacctggtgctctcccagaccaagcaggacattgcacgtgcccgc
aggctccaggcagaggccgaggaggccagaggccgagcccaagctgtggaagggcaggtg
gacgacgtgattgggaaccttcggcagggcaccgtggctctgcaggaagcccaggacact
atgcagggcactggccgctctcttcggctcatccaggaaagggttgctgaggtccagcag
gtgctggggccagccgagaggctggtgacaggcatgaaggagcagatgagtggcttctgg
gcacagatggaggagctccgccgccaggcccaggaggggcaggcacaggcaatgcaggcc
cagcggcttgcagagggtgccagccagcaggcgctgagtgcccaggagggctttgagaga
ctcaagagaaagtatagagagttgaagaaccggctgggccagagtcctgcactgggcgag
caaggcagtcggatcctgagcatcaagactgaggctgaggagctgtttggggagaccatg
ggaatgatggacagaatgaaagacatggagtcagagctgcttcgtgggagtcaggccatc
atgctgcgctcagcggacctgtcagggctagagaagcgcgtggagcagatccgaagttac
atcaatgggcgtgtgctgtactatgccacctgcaagtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110564967
Entry
110564967         CDS       T05884                                 

Gene name
Lama4
Definition
(RefSeq) laminin subunit alpha-4
  KO
K06241  laminin, alpha 4
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05143  African trypanosomiasis
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110564967 (Lama4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110564967 (Lama4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110564967 (Lama4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110564967 (Lama4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110564967 (Lama4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110564967 (Lama4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110564967 (Lama4)
   05145 Toxoplasmosis
    110564967 (Lama4)
   05143 African trypanosomiasis
    110564967 (Lama4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3 Sec34 BORCS6
Other DBs
NCBI-GeneID: 110564967
NCBI-ProteinID: XP_021518187
LinkDB
Position
Unknown
AA seq 1816 aa
MAWNVAWCSVLPLWLLWGAGCSSAASGDGSAFPFDIEGSSVVGRQDPSETSNPRVTLGRL
LPAVERCRAGFFRTLSGECSPCDCNGNSHECLDGSGFCLHCQRNTTGEHCEKCLDGYLGD
SIRGTPRFCQPCPCPLPHLANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEITGQCRNCLRNTTGFKCERCAPGYYGDARTAKNCAV
CNCGGGPCDSVTGECLEEGFELPTGCDKCVWDLTDDLRLAALSMEESKSGLLSVSSGAAA
HRHVNEMNSTIHLLKTRLSERENQYTLRKIQISNAENTMRSLLSDVEELEGKGSKASRKG
KLVEKESMDTIDQATQLVEQAHNMRDKIQEINSKMLFYGENQELGPEEIAERLVLAQKML
QEIRSRQPFITQRELVDEEADEAQELLNQAENWQRLLNDTRSLFPVVLEQLDDYNAKLSD
LQESLDQAHDRVRDAEDMNRVIASKQRDHEKQHERVKEQMEAVGTSLSMSTDSLTVPQLT
LEELDEIIKNASGIYAEIDGAKNELQGKLSNLSNLSHDLVQEATDHAYNLQKEAEELSRN
LHSSDMNGLVQKALDASNVYENIANYVSEANETAELALNITDRIYDAVSGIDTQIIYHKD
ESDNLLNQARELQAKADSSNEEAVADTSRRVGGALWKKGALRDRLNDAVKRLQATERGDA
QQRLGQSKLAIEEANKTTMAVQQVTTPMASNLSNWSQNLQTFDSSAYNTAVDSARDAVRN
LTEVVPQLLDQLRTVEQKRPASNVSASIRRIRELIAQTRSVASKIQVSMMFDGQSAVEVH
PKVSVDDLKAFTSISLYMKPPPKKPEQAGSWIADQFVLYLGSKNAKKEYMGLAIKNDNLV
YVYNLGTKDVEILLDSKPVSSWPAHFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGE
FAGDDSLLDLSPEDTVFYVGGVPANFKLPASLNLPGYSGCLELATLNNDVVSLYNFKHIY
NMDPTKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEVRTPADN
GLVLLMVNGSMFFSLEMRNGYLHVFYDFGFSNGPMHLEDTLKRAQINDAKYHEISIIYHN
DKKMILVVDRRHVKSMDNEKKKIPFTDIYIGGAPQEVLQSRLLRAHLPLDVNFRGCMKGF
QFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGGFNFRT
LQPNGLLFYYASGSDVFSISLDNGTVVMDVKGVKVKAADKQYHDGLPHFVITSISPTRYE
LVVDKSRLGSKNPTKGKAEQTQVTEKKFYFGGSPVSPQYANFTGCISNAYFTRLDRDVEV
ENFQRYSEKVHTSLHECPVESSPLLLLHKKEKNSPKPKTNKQGEQSKDAPLWDPMGLKIP
EQKAPRDSLCHLSNSPRAIEHAYQYGGTANSRQEFEHMHGDFGEKSQFSIRLKTRSSHGM
IFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGVWHDVIFIREKSSGRL
VIDGLRVLEESLPPSGAAWKIKGPIYLGGVAPGRAVKNIQINSVYSFSGCLGNLQLNGAS
ITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRSSSGTLVH
GHSVNGEYLNVHIKNGQVIVKVNNGVRDFSTSVTPKQNLCDGRWHRITVIRDSNVVQLDV
DSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDGRPVSFSK
AALVSGAVSINSCPTA
NT seq 5451 nt   +upstreamnt  +downstreamnt
atggcttggaacgtagcctggtgctcagtgttgcccctgtggctcctctggggtgctggc
tgctccagcgcggcgtcaggggacggcagcgcgtttccttttgacatcgaggggagctca
gtggtcggcaggcaagacccatcggagaccagcaacccgcgtgtgacactgggacgcctg
ctgcccgcggttgagagatgcagggctggattctttcgcacgttgtcaggagaatgttca
ccctgtgactgcaatggcaattcccacgagtgcttggacggttcaggcttctgtctgcac
tgccagcgaaacacaacaggggagcactgtgaaaaatgtctggatggctatcttggagac
tccatcagaggcacaccccggttctgccagccatgcccctgtcccttgccccacctggcc
aactttgcagaatcctgctacaggaaaaatggagctgtccggtgtatttgtaaagaaaac
tatgctgggcctaactgtgaaagatgcgctcccggttactatgggaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaactcagatcccaacctcatctttgaa
gactgcgatgaaatcactggccagtgcaggaattgcctacggaacaccacaggattcaag
tgtgaacgctgtgctcctggctattatggagatgccaggactgccaagaactgtgcagtg
tgcaactgtgggggtggcccatgtgacagcgtcaccggagagtgcctggaagaaggattc
gaactcccaacaggttgtgataagtgtgtctgggacctgaccgatgacctgcgattagca
gcactctccatggaagagagcaaatccgggctgctgagcgtgtcctccggcgccgcggcg
catcgacatgtgaatgagatgaactctaccatccacctcctcaagacaaggctgtctgaa
agagagaaccagtataccctaagaaagattcagattagcaacgccgagaacaccatgagg
agcctcctgtctgatgtggaagaactagaaggaaagggaagcaaagcctcaagaaagggg
aagctggtggagaaggaaagcatggacacgattgaccaagccactcagctcgtagagcaa
gcccacaacatgagggacaaaatccaagagatcaacagcaagatgctcttctacggagag
aatcaggagcttggcccagaggaaattgcggagaggctggtgttggcccagaaaatgctg
caggagatccgaagccggcaaccgttcatcacccagcgggagctcgtggacgaggaggca
gacgaggcccaggaattgctgaaccaggccgagaactggcagcggctgctcaacgacacc
cgctccttgttccccgtggtgctggagcagctggacgactacaacgcgaagctgtcagac
ctccaggagtcactcgaccaggcccacgaccgcgtccgggatgcagaggacatgaacaga
gtcatcgcctccaagcagcgggaccatgagaaacaacatgagagagtgaaggagcagatg
gaagctgtgggcacctctctgagtatgtctacagactctctgacagtacctcagctgacg
cttgaggagcttgatgagataataaagaatgcatctggaatctatgcagaaatagatggt
gccaaaaatgagctacaagggaaactttctaatctaagcaacctcagtcatgatttagtc
caagaagctacagaccatgcatacaaccttcaaaaagaagccgaggagctgagcagaaat
ttgcacagttcagacatgaacgggctggtgcagaaggctttggatgcatcaaatgtctat
gaaaacatcgccaactatgtgagcgaagccaatgaaacagcagaacttgctctgaacatc
actgatcggatttacgatgctgtgagtgggattgacactcagatcatttaccacaaggat
gaaagtgacaaccttctcaatcaagccagagaactgcaagcaaaggcagattccagcaat
gaagaagcagtggctgacaccagcaggcgagtgggaggagccctgtggaagaagggggcc
cttcgagatagactgaatgatgccgttaagcgactgcaagcaacagagagaggggatgcc
cagcagcgcctgggccagtccaagctggccatcgaggaagccaacaagacgacgatggct
gtccaacaggtcaccacaccgatggctagcaacctcagcaactggtcacagaaccttcag
accttcgactcttccgcatataacacggcggtggattcggctcgggatgcagtgagaaat
ctcacagaggtcgtcccccagctcctggatcagcttcgcactgttgagcagaagcggcct
gcaagcaatgtttctgccagcatccggaggatccgagagctcattgctcaaaccaggagt
gttgccagcaagatccaagtctccatgatgtttgatggccagtcggctgtagaagtgcac
cccaaagtcagcgtggatgacctgaaggccttcacatccatcagcttgtacatgaagccc
cctccaaagaagccagagcaggctggctcctggatagctgatcagtttgtcctctacctc
ggaagcaaaaacgccaaaaaagaatatatgggtcttgcaatcaaaaatgataacctggta
tatgtctataatttggggaccaaagatgtggagattctcctggattccaagcctgtgagc
tcctggcctgctcactttagtattgtcaagattgagagggtagggaaacacggaaaggtg
ttcttgacagtccccagtctcagtagcacagcagaagaaaagtttatcaagaagggggag
tttgcaggagatgactccttgctggacctgtccccggaggacactgtgttttatgttggc
ggggtgcctgcgaacttcaagctccctgccagcttaaacctgcccggctactcgggctgc
ctggagctggccactctgaataatgatgtcgtcagcctgtacaacttcaagcatatctac
aacatggatccgaccaagtccgtgccttgtgccagggataaactggctttcactcagagc
cgggccgccagctatttcttcgatggttccagttacgccgtggtgagggacatcacaagg
agaggaaaattcggtcaggtgacccgctttgacattgaagttcgtacgccagctgataac
ggccttgtgctactgatggtcaatggaagtatgtttttcagcctagaaatgcgaaatggc
tacctacacgtgttctatgactttggattcagcaacggccccatgcatctcgaagacaca
ttgaaaagagcccagatcaatgatgcaaaataccacgagatctcaatcatttaccacaat
gacaagaaaatgattttggtagtggacagacgacatgtcaagagcatggacaatgagaag
aagaaaattcctttcacagacatctacattggaggtgcaccccaagaagttttacagtcc
aggttgctaagagcacatcttcctctagatgtcaacttcaggggatgcatgaagggtttc
cagttccaaaagaaagatttcaatttactggagcagacagaaaccctaggcgttggttac
ggctgcccagaggactctctgatatctcgcagagcatatttcaacgggcaaagttttatt
gcttcaattcagaaaatatctttctttgatggctttgaaggaggcttcaatttccgaaca
ttgcagccaaacgggttgctattctactatgcttcagggtccgacgtgttttccatctcg
ctggacaacggcaccgtcgtcatggatgtaaagggggtcaaggtcaaggcagcagacaag
cagtaccacgacgggctgccccacttcgtcatcacctccatctcacccacaagatacgaa
ctggtggtggacaaaagccgacttgggagcaagaatcctacgaaggggaaggcagaacag
acccaagtgactgagaagaagttctacttcggtggctcaccagtcagtccccaatatgct
aatttcactggatgcataagcaatgcctacttcaccaggttggatagagatgtggaagtc
gagaatttccagcggtattctgaaaaggttcatacctcgctccacgagtgccccgttgag
tcgtcaccactgcttctccttcacaaaaaagaaaaaaattccccgaagcccaaaacaaat
aagcagggagagcaaagtaaagatgcacctttatgggatcctatgggcctgaagatccca
gaacagaaggctccacgggactcactctgccacctgtccaacagccccagagcaatagaa
cacgcctatcaatatggaggcacagccaacagtcgccaagagtttgaacacatgcacgga
gatttcggtgaaaaatctcagttttccattcgtctgaaaacccgttcctcacatgggatg
attttctatgtctcagaccaagaagagaatgatttcatgactctgttcttggcccacggt
cgcttggtcttcatgtttaatgttggccacaagaaactgaagattagaagccaggagaaa
tacaatgacggagtgtggcatgatgtgatatttattcgggaaaagagcagtggcagactg
gtcattgatggtctacgagtgctagaagaaagccttcctcctagtggggctgcctggaaa
attaaaggtcccatttatttgggaggagtagctcctgggagagctgtgaaaaacatccag
attaactctgtctacagcttcagtggctgccttggcaatctacagctcaatggtgcctcc
atcacctctgcttctcaaacatttagcgtgacgccttgctttgaagggccaatggaaaca
ggaacttacttttccacagaaggaggctatgtggttctagatgagtccttcaatattggg
ttaaagtttgaaattgcatttgaagtccgtccccggagcagttctggaaccctggttcat
ggccacagtgtcaacggggagtacctgaatgtgcacataaaaaacgggcaggtcatagtg
aaagtcaacaacggtgtcagagacttttctacctcagtaactcccaagcagaatctctgt
gatggcagatggcaccgaattacagttattagagactcaaacgtggttcaattggatgta
gattcagaagtgaaccacgtagttggaccactgaatccaaagccagttgatcacagggag
cctgtgtttgttggaggcgtcccagagtctctactgacgccgcgtttggctcccagcaaa
cccttcacaggctgcatccgccactttgtgattgacgggcgcccagtgagcttcagtaaa
gcagctctggtcagcggcgccgtgagcatcaactcctgtcccacagcctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110565216
Entry
110565216         CDS       T05884                                 

Gene name
Lamb2
Definition
(RefSeq) laminin subunit beta-2
  KO
K06243  laminin, beta 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04151  PI3K-Akt signaling pathway
mun04510  Focal adhesion
mun04512  ECM-receptor interaction
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05165  Human papillomavirus infection
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    110565216 (Lamb2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110565216 (Lamb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110565216 (Lamb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110565216 (Lamb2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110565216 (Lamb2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110565216 (Lamb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110565216 (Lamb2)
   05145 Toxoplasmosis
    110565216 (Lamb2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 110565216
NCBI-ProteinID: XP_021518529
LinkDB
Position
Unknown
AA seq 1801 aa
MEWASGEPGRGRQGQLVPWELRLGLLLSGLAATMAQVPSLDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGIPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWRVYRY
FSYDCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
SLLKITNLRVNFTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPG
APAHAEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWHPAEDGQTHACRKCECNGHTQSCH
FDMAVYLASGNASGGVCDGCQHNTAGRHCELCRPFFYRDPTKDIRDPAVCRPCDCDPMGS
QDGGRCDSHDDPVLGLVSGQCRCKEHVVGARCQQCRDGFFGLSASDPRGCQRCQCNSRGT
VPGGNPCDSNSGSCFCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEA
TGQCRCRLHMIGRRCEQVQPGYFRPFLDHLTWEAEEARGQMLEVVERPVTNLETPSWTGQ
GFVRLREGQGVEFLVTSLPKAMDYDLLLRLEPQVPEQWAELELTVQRPGPVSAHSPCGHV
LPKDDRFQGMLQPNARFLMFPRPVCLEPGLTYKLNLKLIRTGGRAHPETPYSGSGLLIDS
LVLQPHFLVLEMFSGGDAASLERRTTFERYRCHEEGLMPRKTPLSEACAPLLISLSSLIY
NGALPCQCDPQGSLSSECNPHGGQCLCKPGVVGRRCDTCATGYYGFGPAGCQACQCSPEG
ALSALCEGTSGQCPCRTGAFGLRCDRCQRGQWGFPNCRPCVCNGHADECDTHTGACLSCR
DYTGGEHCERCIAGFHGDPRLPYGNQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCHCR
AGYTGLRCEACAPGHFGDPSKPGGRCQQCECSGNIDPTDPDACDPHTGQCLRCLHHTEGP
RCGHCKPGFHGQAARQSCHRCTCNLLGTDPRQCPSSDQCHCDPRSGQCPCLPHVQGLSCD
RCAPNFWNFTSGRGCQPCACHPSRATGPTCNEFTGQCHCHAGFGGRTCSECQELHWGDPG
LQCRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHVCFGDW
DRVVQDLAARTRRLEQWAQELQQTGVLGAFESSFLDMQKMLGMVQAIVGARNTSAASTAK
LVEATEGLRHEIGKTTERLTQLEAELTDVQDENFNANHALSGLERDGLALNLTLRQLDQH
LDILKHSNFLGAYDSIRHAHSQSTEAERRANTSTLAVPSPVSNSADTRRRTEMLMGAQKE
NFNRQHLANQQALGRLSAHTHALSLTGVNELVCGAPGDAPCATSPCGGAGCRDEDGQPRC
GGLGCGGAAATADLALGRARHTQAELQRALVEGGGILSRVSETRRQAEEAQQRAQEALDK
ANASRGQVEQANQELRELIQSVKDFLSQEGADPDSIEMVATRVLELSIPASPEQIQRLAS
EIAERVRSLADVDTILAHTMGDVRRAEQLLQDAQRARSRAEGEKQKAETVQAALEEAQRA
QGAAQGAIRGAVVDTQDTEQTLHQVQERMAGAEQSLKSASERARQLDALLEALKLKRAGN
SLAASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDE
AQGLLQAAQDKLQRLQELEGTYEENERQLEGKAVQLDGLEARMRSVLQAINLQVQIYNTC
Q
NT seq 5406 nt   +upstreamnt  +downstreamnt
atggagtgggcctcaggagaaccagggaggggcaggcagggacagcttgtgccatgggaa
cttcgcttgggcctacttctaagtgggctggctgccacaatggcccaggtcccatccttg
gatgtacctggctgttcccgaggaagctgctatccagccaccggtgacctgttggtgggc
cgtgcagacagactgactgcctcatccacctgtggcttgcatagccctcaaccctactgt
attgtcagtcacctgcaggacgagaagaagtgcttcctgtgtgattcccggcgccccttc
tccgcccgggacaacccgaacagccatcggatccagaatgtggtcaccagctttgcaccg
cagcgccgcacggcctggtggcagtcggagaatggtattccaatggtcaccatccagctg
gacttggaagctgaattccatttcacccacctcattatgaccttcaagacatttcgtcct
gctgccatgctggtggagcgctctgcggacttcggccgcacgtggcgtgtgtaccgctat
ttttcctatgactgcggggctgacttcccaggagtccccctggcccccccacggcactgg
gacgatgtggtctgtgagtcccgctactcggaaatcgagccatccacggaaggcgaggtc
atctatcgcgttctggaccccgctatccctatcccagacccctacagctcacggatccag
agcctgttgaagatcaccaacctccgagtgaacttcactcggcttcacactttgggagac
aacttgctcgacccacggcgggaaatccgggaaaaatactactacgccctctacgagctc
gtcatccgcggcaattgcttctgctacgggcatgcctcgcagtgtgccccggccccgggg
gcaccggcccatgccgagggcatggtgcacggggcctgtgtctgcaagcacaacactcgc
ggtctcaactgtgagcagtgtcaggatttctatcacgaccttccctggcaccctgctgaa
gacggccagactcacgcctgtcggaagtgtgagtgcaatgggcacacgcagagctgccac
tttgacatggctgtctacctggcgtccggaaacgcgagcggaggagtatgcgatggctgc
cagcacaacacggcggggcgtcactgtgagctctgccggcccttcttctaccgggaccca
accaaggacatccgggatcctgccgtgtgccgtccctgtgactgtgaccccatgggttct
caagacggcggtcgctgtgattcccatgacgaccctgtgctagggctggtctcgggccag
tgtcgctgcaaagaacatgtggtcggcgctcgctgccagcaatgccgtgatggcttcttc
ggacttagtgccagtgaccctcgagggtgccagcgttgtcagtgtaattcccggggcaca
gtgcctgggggcaacccttgtgactccaacagtggaagctgtttctgcaagcgtctggtg
actggacgtggctgtgaccgctgcttgcctggacactggggcctgagccatgacctgctg
ggttgccgcccctgtgactgcgacgtgggaggagccttggatccccagtgtgatgaggcc
acgggtcagtgccgctgccgcctgcacatgattgggcgtcgctgcgagcaagtacagccc
ggctacttccggccatttcttgaccatttaacttgggaggctgaggaggcccgaggacag
atgctcgaggtggtagagcgtccggtgactaacttagagactccatcctggactggccag
ggcttcgtgcggctgcgggaaggtcaaggagtggagttcctggtgacctctttgccaaag
gccatggactacgacctgctactgcgcttggagccccaggttcctgagcaatgggcagag
ctggaactgacggtgcagcgtccagggcctgtgtctgcccacagtccgtgtgggcatgtg
ctgcctaaggatgaccgctttcaggggatgctgcaaccaaacgccaggtttttgatgttt
cctagacctgtctgcctcgagcctgggctcacctacaagttgaatctgaaactgattcga
acaggtggacgtgcccatccggaaaccccctactctggatctgggctactcattgattcg
ctggtgctgcagcctcacttcttggtgctagagatgttcagtggcggtgacgccgcctcc
ctggagcgccggaccaccttcgagcgttaccgctgccacgaggaaggtctgatgcccaga
aagacccctctatcggaggcctgtgcacccctcctcatcagcctgtcctccttgatctac
aatggtgccttgccatgtcagtgcgacccccaaggctcgctgagttctgagtgcaatcct
catggtggccagtgcctgtgcaaacctggagttgttggacgccgctgtgacacctgtgcc
actggctattatggctttggccctgcaggctgtcaagcctgccagtgtagtcctgaggga
gcactcagtgccctatgtgaagggactagtggacagtgtccctgccgaactggtgccttt
ggtcttcgctgtgaccgttgccaacgtggccagtggggattcccgaactgccggccctgt
gtctgcaatgggcatgcagatgaatgtgatacccacacaggcgcttgcctgagctgccgg
gattacacagggggcgagcactgtgaaaggtgcattgctggttttcacggggacccacgg
ctgccgtatgggaaccagtgccggccttgtccctgtcccgaaggccctgggagccagcgg
cactttgctacgtcttgccaccgggatggatattcccagcaaattgtgtgccactgccga
gcaggctacacagggcttcggtgtgaggcttgcgcccctgggcactttggggacccatca
aagccaggtggcagatgccaacagtgcgagtgcagtggaaacattgaccccactgatcct
gatgcctgtgacccccacaccgggcaatgcttgcgctgtttacaccatacggagggtccc
cgctgtggtcattgcaagcctggcttccatgggcaggctgcccgacagagctgtcaccgc
tgtacctgcaaccttctgggcacagatccccggcagtgcccatcctctgatcagtgccac
tgtgacccacgcagtgggcagtgcccatgcctcccccacgtccaaggccttagttgtgac
cgttgtgcccccaacttttggaacttcaccagtggccgtggctgccagccttgtgcttgc
cacccgagccgggccacaggccctacctgcaatgagttcacagggcagtgtcactgtcat
gccggctttggtgggaggacttgttctgaatgccaagagctccactggggagaccccggc
ctgcagtgtcgtgcctgtgattgtgatcctagaggaatagacaaacctcagtgtcaccgt
tccactggccactgtagctgccgcccgggcgtgtccggcgtgcgctgtgaccagtgtgct
cgtggcttctcaggcgtctttcctgcttgtcacccctgccatgtgtgctttggagactgg
gaccgggtggttcaggacttggctgcccgtactcggcgcctggagcagtgggctcaggag
ctgcagcagacgggtgtgctgggtgcctttgagagcagctttttggacatgcagaagatg
ctgggcatggtgcaggccatcgtgggtgcccgcaacacctcagctgcctccactgcaaag
cttgtcgaggccacagagggactgcgccatgaaatcgggaagaccactgagcgcctgact
cagttagaagcagagctaacagatgtacaggatgagaacttcaatgccaaccatgccctc
agtggtctggagagagatgggcttgcgcttaatctcacgctgaggcagcttgaccagcat
ctggatatcctcaaacattcaaatttcttaggtgcctatgacagcatccgacatgcccac
agccagtctacggaagcagaacgccgcgccaacacctccaccctcgcggtacccagcccc
gtgagcaactcagcggatacccggcgtcggacagaaatgctgatgggtgcccaaaaagaa
aacttcaaccgccaacacttggccaaccagcaggccctgggacggctctctgcacatacc
cacgccctgagcctgaccggcgtaaatgagctggtgtgtggggccccaggggacgcaccc
tgtgctaccagcccttgtgggggtgccggatgtcgggatgaggatgggcagccccgttgt
ggtggcctcggttgcggtggggcagcagccactgcggatctagcactgggccgggctcgg
cacacacaggcagagctgcagcgggcactggtagaaggtggtggcatcctcagccgagtg
tctgagactcgtcggcaggcagaggaggcacagcagcgggcacaggaagccctggacaag
gctaatgcttctaggggccaagtggagcaggccaatcaggagcttcgagaacttatccag
agcgtgaaggacttcctcagccaggagggagctgatcctgacagtattgaaatggtagcg
acacgggtgctggaactgtccatcccagcctcaccggagcagatccagcgcctagcaagt
gagattgcagaacgtgtccgaagcctggcagatgtggacacaatcctggcacatactatg
ggggatgtgcgtcgggctgagcagctactacaggatgcacagcgggcacggagccgggct
gagggtgagaagcagaaggcagagacggtacaagcagccctggaggaggctcagagggca
cagggtgccgctcagggtgccatccggggagcagtggttgacacccaggacacggagcag
accctgcaccaggttcaggagaggatggcaggtgcagagcagtccctcaagtctgctagc
gagcgggctcggcaattggatgccctcctagaggccctgaaactgaaacgggcaggaaat
agcctggcagcctctacagctgaggaaacagcaggcagtgcccagagccgtgccagggag
gctgagaagcaactgcgggaacaagtgggtgaccagtaccaaactgtgagggcactggcc
gaacggaaggctgaaggcgtgctggctgcgcaagccagggccgagcagctgcgggatgag
gcgcagggcctgttgcaggctgctcaagacaagctgcagcggctccaggaactggagggc
acttatgaagagaatgagcgtcaactggagggcaaggcggtccagctggatgggctggaa
gccaggatgcgcagtgtgcttcaggccatcaacctgcaggtccagatctacaacacctgc
cagtga

DBGET integrated database retrieval system