KEGG   Meriones unguiculatus (Mongolian gerbil): 110546375Help
Entry
110546375         CDS       T05884                                 

Gene name
Aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00010  Glycolysis / Gluconeogenesis
mun00053  Ascorbate and aldarate metabolism
mun00071  Fatty acid degradation
mun00280  Valine, leucine and isoleucine degradation
mun00310  Lysine degradation
mun00330  Arginine and proline metabolism
mun00340  Histidine metabolism
mun00380  Tryptophan metabolism
mun00410  beta-Alanine metabolism
mun00561  Glycerolipid metabolism
mun00620  Pyruvate metabolism
mun01100  Metabolic pathways
Module
mun_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110546375 (Aldh2)
   00053 Ascorbate and aldarate metabolism
    110546375 (Aldh2)
   00620 Pyruvate metabolism
    110546375 (Aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110546375 (Aldh2)
   00561 Glycerolipid metabolism
    110546375 (Aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110546375 (Aldh2)
   00310 Lysine degradation
    110546375 (Aldh2)
   00330 Arginine and proline metabolism
    110546375 (Aldh2)
   00340 Histidine metabolism
    110546375 (Aldh2)
   00380 Tryptophan metabolism
    110546375 (Aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110546375 (Aldh2)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110546375 (Aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235 HetR_C
Motif
Other DBs
NCBI-GeneID: 110546375
NCBI-ProteinID: XP_021488840
LinkDB All DBs
Position
Unknown
AA seq 519 aa AA seqDB search
MLRAALATARRGPRLSRLLSAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVN
PSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLFRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIV
PGFGPTAGAAIASHGDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIILSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVHEDVYDEFVERSVSRAKSRVVGNPFDSRTEQ
GPQVDETQFKKILGYIKSGQQEGAKLLCGGGPAADRGYFIQPTVFGDVKDGMTIAREEIF
GPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVFGA
QSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgccgcactcgccaccgcccgccgcgggccgcgcctcagccgcttgctgtcc
gctgccgccaccagcgccgtgccggcccccaaccagcagcccgaggtcttctgcaaccag
atcttcattaacaatgagtggcacgatgccgtcagcaagaaaacattccccaccgtcaac
ccttccacgggagaggtcatctgccaggtagcagaagggaacaaggaggacgtggacaag
gcagtgaaggccgctcgggcagctttccagctgggctcaccctggcgccgcatggatgca
tccgacaggggcaggctgctcttccgactggccgatctcatcgagcgggaccggacctac
ctggctgccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggat
ttggacatggtgctgaaatgtctccgctattatgctggctgggccgataagtaccatggg
aaaaccattcctatagatggcgacttcttcagctacacccgccacgagcctgtgggggtg
tgtggacagatcattccgtggaacttcccgctcctgatgcaagcatggaagctgggcccg
gccctggcaactggaaacgtggttgtgatgaaagtcgctgagcagacgccgctcaccgca
ctctacgtggccaacttgatcaaggaggcaggcttcccccctggcgtggtcaacattgtt
cctgggttcggccctaccgccggggccgccatcgcttcccatggggacgtggacaaagtg
gccttcacaggttctactgaggttggtcacctgatccaggttgccgcggggagcagcaac
ctcaagagagtaacgctagagctggggggcaagagccccaacatcatcctgtcggatgcc
gacatggactgggctgtggagcaggcccactttgccctgttcttcaaccagggccagtgc
tgttgcgccggctcccggacctttgtccatgaggatgtgtacgatgagttcgtggagcgc
agtgtttccagggccaagtctcgggtggtcgggaacccctttgacagccggacggagcag
gggccgcaggtggatgagactcagtttaagaagatcctcggctacatcaagtcaggacag
caggagggggcgaagctgctgtgtggcggaggccctgccgccgaccgcggctacttcatc
cagcccaccgtgtttggagacgtgaaggacggcatgaccattgccagggaggagatcttc
ggtccagtgatgcagatcctcaaattcaagaccatagaggaggttgtggggagagccaat
gattccaagtatgggctggcagcagctgtcttcacaaaggacctggataaggccaattac
ctgtcccaagccctccaggccggcactgtgtggatcaactgctatgatgtgttcggggcc
cagtccccatttggtggctacaagatgtcggggagcggcagggagctgggcgagtatggc
ctgcaggcctacacagaagtgaagacagtcactgtcaaagtaccacagaagaactcgtaa

DBGET integrated database retrieval system