KEGG   Meriones unguiculatus (Mongolian gerbil): 110546429
Entry
110546429         CDS       T05884                                 

Gene name
Gli2
Definition
(RefSeq) zinc finger protein GLI2
  KO
K16798  zinc finger protein GLI2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun04390  Hippo signaling pathway
mun05200  Pathways in cancer
mun05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110546429 (Gli2)
   04390 Hippo signaling pathway
    110546429 (Gli2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110546429 (Gli2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110546429 (Gli2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110546429 (Gli2)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110546429 (Gli2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 110546429
NCBI-ProteinID: XP_021488930
LinkDB
Position
Unknown
AA seq 1540 aa
MEMSAPAPAVEKKEAKSGLLEDSSFPDPGKKACPLVVAAAAAVAAQGVPQQLLPPFHAPL
PIDMRHQEGRYHYDPHSVHSVHGPPALSGSPVISDISLIRLSPHPAGPGESPFSAHHPYV
SPHMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFGLAAPATNPSDYYHQMTL
MASHPTPYGDLLMQSGGAASAPHLHDYLNPVDASRFSSPRVTPRLSRKRALSISPLSDAS
LDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILSQ
QRGLGSAFGHTPPLIQPSPTFLAQQPMALTSISTMPTQLSSNSSDCLNDANQNKPSSESA
VSSTVNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEVVIYETN
CHWADCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHT
GEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTH
SNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRAPLLKENGDNEA
SAEPGGRGPEESVEASSTSHAVEDCLHIKAIKTESSGLCQSSPGAQSSCSSEPSPLGSAP
NNDSGVEMPGTGPGSLGDLTALDDASPGADTSTLAAPPTGGLQLRKHMTTMHRFEQLKRE
KLKSLKDSCSWAGPAPHTRNTKLPPLPANGSVLESFNSTGGGGPAGLLPNQRLPELTEVT
MLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASPLGAGRPHNASSADSYDP
ISTDASRRSSEASQCSGGVPGLLNLTPAQQYSLRAKYAAATGGPPPTPLPGLERVSLRTR
LSLLDGPERALPGACPHPLGPRRGSDGPAYGHGHGHGYVGAAPTFPHEGPGSNMRRASDP
VRRPDPLVLPRVQRFHSTHNMNPGSLPPCADRRGLHLQSHPSVDGSLTRNTYSPRPPSIS
ENVVMEAVAAGVDGTGLESDLGLVEDELVLPDDVVQYIKAHTGGALDDSTRQVYPTESAG
FPENSKLPSPGLQGHRRLAAADSNVGPSAPGLGGCQLRYSPSTNLNKNNMPVQWNEVSSG
TVDVLPTQVKSFPHSNLAVVQQKPAFSQYPGYSPQALQASSGGLDSTQPHLQLRGAPSAP
RGSYAQQPRQPATGGQCLSMAAAMSPQASYSHAHSQLSPNVVSGPLNQFSPSCSNMAAKP
SHLGLPQQMEAIPNATIMSGHQRDLGIPSSSLAGVAQSHPVLSYPQQEGYQQGSSLLSSH
QPSFMESQQNSGFGLMQPRPPQEPNTASRHRGVRAGHLYARTTGQAMVTSANQETAEAMP
KGTAGPVVSLAPQPSQDTGQPQDQNTLYYYGQIHMYEQNGGCPAMQPQPSQPQACSDNIQ
PLPSPGVNQVSSTVDSQLLEPPQIDFDAIMDDGDHSSLFSGALSPTLLHNLSQNSSRLTT
PRNSLTLPSIPAGISNMAVGDMSSMLTSLAEENKFLNMMT
NT seq 4623 nt   +upstreamnt  +downstreamnt
atggagatgtccgccccagcccctgcagtggagaagaaagaagccaagagtggcctgttg
gaggacagcagcttccccgacccagggaaaaaggcttgtcctctggtggtagcggcagcc
gcagctgtagcagcccaaggagttcctcagcagctcctgccgcctttccacgcgcctttg
ccaattgacatgcgccaccaggagggaaggtaccattatgatcctcactctgtccacagt
gtgcacgggcctcctgccctgagtggcagcccggtcatctcagatatctccttgatccga
ctttccccacaccctgcgggccctggggagtctcccttcagcgcccaccatccctacgtg
agtcctcatatggagcactacctccggtctgtgcacagcagccccacgctctcaatgatc
tctgcagccaggggcctcagccctgctgacgtggcccacgagcatctgaaagagagggga
ctgttcggtcttgctgccccagccaccaacccttcagactattaccaccagatgaccctc
atggccagccaccccaccccctatggggaccttctaatgcagagtgggggtgctgcgagc
gcaccccatctccatgactacctcaatcctgtggatgcgtcacggttctctagcccacgt
gtgacccctcgcctgagccgcaagcgggccctgtccatctccccgctctcagatgccagc
ctcgacctgcagcgcatgatccggacctctcccaactcactggtagcttacatcaacaac
tcgaggagcagctcggcagccagtggctcctatgggcacctgtcggccggcgcactcagc
ccagctttcactttcccccaccccatcaatcctgtggcctaccaacagattctgagccag
caaaggggcctgggctcagcctttggacacacaccacccctgatccagccctcacccacc
ttcctggcccagcagcccatggctctcacctccatcagcaccatgcctacccagctcagc
agcaatagcagcgattgtctaaacgatgccaaccagaacaagccgagcagcgagtcagct
gtgagcagcaccgtgaacccaatcaccattcataagcgtagcaaggtcaagactgaggcc
gagggcctgcggccagcctccccactaggactgacgcaggagcagctggccgatctcaag
gaagacctggacagggatgactgtaagcaggaggctgaggtggtcatctatgagaccaac
tgccactgggcagactgcacaaaggagtatgacacacaggagcagctggtgcaccacatc
aacaacgagcacatccacggggagaagaaagagttcgtgtgccgctggcaggcctgcacc
agagagcagaagcccttcaaggcccagtacatgctggtggtacacatgcgcaggcacacg
ggggagaagccgcacaagtgcacgttcgaaggctgctcaaaggcctactctcgcctggag
aacctgaagacacacctgcggtcccacacaggagagaagccatatgtgtgtgaacatgag
ggctgcaacaaggccttctccaatgcctcggaccgtgccaagcatcagaaccgcactcac
tccaacgagaaaccctatatctgcaagatcccaggctgcaccaagaggtacacagacccc
agctcactccgcaagcacgtgaagactgtccatggcccagatgcccacgtcaccaagaaa
cagcgcaacgatgtgcatctccgtgctcctctgctcaaggagaatggggacaatgaggcc
agtgctgaaccaggtggacggggacctgaggagagtgtggaggccagtagcaccagccac
gctgtagaggactgcctacatatcaaagccatcaagacagagagctccgggctatgtcag
tccagccccggggcccagtcatcctgcagcagcgagccctctcccctgggcagtgccccc
aacaatgacagtggcgtggagatgccagggacagggcccgggagtctgggagacctgaca
gcgctggatgacgcgtctccgggagctgacacctccacgctggctgccccccccaccggt
ggcctgcagctgcgcaaacacatgactaccatgcatcgctttgagcagctgaagagagag
aagctcaagtccctcaaggattcctgctcgtgggccggcccagctccacacacccgcaac
accaagctgcctcccctcccagccaatggttctgtcctggaaagcttcaacagcactggg
ggcggtgggccagcgggactgctgcccaaccagcggctgccagagctgacggaagtgacg
atgctgagccagctgcaggaacggagggatagctccaccagcaccgtgagctcagcctac
accgtgagccgccgctcctccggcatctccccctacttctccagccgtcgctccagtgag
gcttcccctctcggtgccggccgcccacacaatgccagctcggcagactcctatgacccc
atctccacagatgcctcccggcgctccagcgaggcgagccagtgcagcggtggggtccca
gggttactcaacctcacgcctgcgcagcagtacagcctgcgcgccaagtacgcagcagcc
acgggtggaccaccacccacgccactgccgggcctcgagcgtgtaagccttcgtacccgc
ctgtcattactagatggtcccgagcgtgccctgcccggggcctgcccacatccgctgggg
ccgcggcgtggcagcgatgggcctgcctatggccatggtcatggccatggctatgtaggg
gcagctcctaccttccctcacgaggggcccggcagcaacatgcggcgggccagcgaccct
gtgcggcgacctgaccccctcgttctgcctcgagtgcagcgtttccacagtacccacaat
atgaatccaggttcactgccaccctgcgctgatcggcgaggcctgcatctacagagccac
cccagcgtggatggcagcctgacccgcaacacctactcccccagaccgcctagcatcagt
gagaacgtggtgatggaggctgtggccgctggggtagatggaacagggctggagtccgac
ctggggctggtggaggatgagctggtgctgccggacgatgtggtacaatacatcaaagct
cacaccggcggcgccttggatgacagcacacggcaggtgtatcccacagaaagcgctggc
ttccctgagaactcgaaactgcccagtcctgggctacaaggccaccgcaggctagcagct
gccgactcaaatgtgggcccttctgctcctgggctggggggctgccagctgcgctacagc
ccctcaaccaacctcaacaagaacaacatgcctgttcagtggaatgaggtgagttctggc
accgtggatgtcctacccacccaggtcaagtctttcccacacagcaatctggccgtggtt
cagcagaagccagccttcagccagtatccaggatatagtccacaagccctgcaggccagc
tctgggggtctagacagcacccaaccacacctacagcttcgaggagctccttctgcaccc
agggggagctacgctcagcagcctcgacagccagccacaggcggtcagtgcctgagcatg
gctgctgccatgagtcctcaggccagctacagccatgcccactcccagctgagcccaaac
gtcgtcagtggacccctgaaccagttctccccctcctgcagcaatatggcggccaagccc
agccacctgggactccctcagcaaatggaagctatccccaatgctaccatcatgagtggc
catcaacgagatctcgggattcccagctcatccctggctggggtggcccagtctcaccca
gtcctgagctatccccagcaggaaggctaccagcagggctccagccttctgtcatcccat
cagcctagcttcatggagtcccagcagaactcgggctttggtctcatgcagcctcggccg
ccccaagagcccaacactgctagtcgtcaccgtggagtgcgtgctggacacttgtatgcc
aggaccactggccaagccatggtcacatcagccaaccaagagacagcggaagctatgccc
aagggaacagcagggcccgtggtgtccctggctcctcagccatctcaggacacaggccag
ccacaggaccagaacacactctactactatggccagattcacatgtatgaacagaacgga
gggtgcccagccatgcagccccagccatcacaaccacaagcttgctcagacaatatccag
cctctgccttcaccaggggtcaaccaggtgtccagcactgtggactcgcagctcctggag
cccccccagattgactttgatgccatcatggatgatggcgatcactcaagtttgttctct
ggtgcattgagccccacccttctccacaatctctcccagaattcctcacgcctcacgaca
ccccggaattccttgacgctgccctccatccctgcaggcatcagcaacatggctgttgga
gacatgagctccatgctcaccagcctggctgaagagaacaagtttttaaatatgatgacc
taa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110550293
Entry
110550293         CDS       T05884                                 

Gene name
Gli3
Definition
(RefSeq) transcriptional activator GLI3
  KO
K06230  zinc finger protein GLI3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04024  cAMP signaling pathway
mun04340  Hedgehog signaling pathway
mun05200  Pathways in cancer
mun05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110550293 (Gli3)
   04024 cAMP signaling pathway
    110550293 (Gli3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110550293 (Gli3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110550293 (Gli3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110550293 (Gli3)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110550293 (Gli3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 110550293
NCBI-ProteinID: XP_021495756
LinkDB
Position
Unknown
AA seq 1583 aa
MEAQSHSSTTTERKKAENSIGKCPTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQSVQGLSKISEEPSTSSDERASLIKKEIHGSLPHLAEPSLPYRGTVFAMDPRNGYVEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVPSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADILPSAATAGAGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGSRGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCTREFDTQDQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDMHPRPPPPRDSGSHS
QSRSPGRPTQGAFGEQKELGNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPV
SNYSNSGPELPLTDGGGVADLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHIKL
ERLKQVNGMFPRLNPILPSKAPAVSPLIGNGTQSNNNYSSGGPGTLLPSRGDLSGVDFTV
LNTLNRRDSSTSTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQGDGLPSLLSLTPVQQYRLKAKYAAATGGPPPTPLPHMERLSLKTRMALL
GEGRDSGVTLPPVHPPRRCSDGGGHTYSRRHLLPHDALANSVRRASDPVRTVSENMSLPR
VQRFSSLNSFNPPSLPPSVEKRSLVLQNYTRPEGSQARFFQASPCPPSITENVALEALTM
DADANLNDEDFLPDDVVQYLNSQNQTEYGQQLQSAISEDSKVAHGPENLDLPDLPDSHVG
QQYPALEQPCSEGSKTDLPIQWNEVSSGSSDLSSSKLKCGQRPTVQQARAFGLYNNMVAH
PQNLWKVGTGPTGGCQILGENGSTYSGPEHFVIHSGDGPGPNGNAFHEQPYKTQQYGSQI
NRQPLASSTLDSACGAGLQGAKLKGNTLQENGNLLDFALSTAPNELAGNTVNGIPAQDPM
GQGYIAHQLLSGSMQHQGASRPGQQILGQVGATSHVNIYQGTESCLTGTQDNSSQPASMA
VVRGYQPCAGYGGSRRQAMPRGSLTLQQGQLSDVSQSSRVNGIKMEAQGQSQQLCASMQN
YSGQFYDQIASGFSQQDRKAASFSLSDANCLLQGNGTENSELLSPGANQVTSTVDSFESH
DLEGVQIDFDAIIDDGDHTSLMSGALSPSIIQNLSHSSSRLTTPRAPLPFPALSMSTTNM
AIGDMSSLLTSLAEESKFLAVMQ
NT seq 4752 nt   +upstreamnt  +downstreamnt
atggaggcccagtcccacagctccacaaccactgagaggaagaaagctgagaattccatc
gggaaatgtcccacaagaacagatgtcagtgagaaggccgtggcctccagtaccacttca
aatgaggatgaaagtcctggacagacctatcaccgagagagaagaaacgcaatcactatg
cagcctcagagtgtgcaggggctcagcaaaatcagtgaggagccctcaacatctagtgat
gagagggcctcactgatcaagaaggagatccatggatctctgccacatctggcagagccc
tctctcccttatcgtggaactgtgttcgccatggacccccggaatggttacgtggagcct
cactaccaccctcctcatcttttccctgccttccatcctcctgtaccaattgatgccaga
catcatgagggccgttaccattacgatccatctcctattcctccattacatgtgccttct
gccttatctagtagcccgacgtatccagacctgcccttcattaggatctccccacaccgt
aaccccactgcagcttcagagtcccccttcagccccccacacccctacatcaacccatat
atggactacatccgctccttgcacagcagcccgtccctctccatgatctcagcggcccga
gggctgagccctacagacgccccccatgctggagtcagccctgcggaatactatcaccag
atggccctgctgacaggccagcgcagcccctacgcagacatcctcccgtcagccgccacc
gctggtgcaggggccatccacatggagtaccttcatgccatggatagcaccagatttccc
agccccaggctgtcagctaggcccagccgaaagcgcacactgtccatatcaccactgtcc
gatcatagcttcgaccttcagaccatgataagaacatctcctaactccttggtcacaatt
ctcaataattctcgtagcagctcttcagctagtggctcctatgggcacttatcggcaagt
gcaatcagccctgctttgagctttacctacccctccgcccctgtgtctctccatatgcat
caacagatcctaagccgtcagcaaagtttaggctcagcatttggacacagccctccgctc
atccaccctgctccaacattcccaacacagagacctatccctggaatcccaacggttctg
aaccctgtccaggtcagctctggcccttctgagtcctcacagaacaagcccacaagtgag
tctgcagtcagcagcactggagaccctatgcataataagcggtccaagatcaaacccgat
gaagacctccccagcccggggtcccggggacagcaggaacagcctgaaggaacaacccta
gtcaaggaggaaggggacaaagatgaaagcaagcaggagcctgaagtcatctacgagaca
aactgccactgggaaggctgcaccagagagttcgacacccaggatcagctcgtgcatcat
atcaataatgaccacattcatggagaaaagaaggagtttgtgtgccgctggctggattgt
tcaagagagcagaagcccttcaaagcccagtacatgttggtagtgcatatgagaagacac
actggcgagaagcctcacaagtgtacctttgaaggttgcacaaaagcctactcgagacta
gaaaacctgaaaacgcacttgagatctcacactggagagaagccatacgtctgtgaacac
gagggctgcaacaaggcattctccaacgcttcggatcgggctaagcaccaaaacagaacg
cattccaatgagaaaccatatgtatgcaaaatccctggctgcaccaagcggtacacagac
cccagctctctccggaagcatgtgaagactgtgcatggccctgaggctcatgtcaccaaa
aagcagcgtggggacatgcaccctcggcctccacccccgagagattctggcagccattcg
cagtccaggtcccccggccggccgactcagggagcctttggtgagcagaaagagctgggc
aacactacctcaaagcgggaagaatgcctccaggtgaagacggtcaaggccgagaaaccc
atgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccgtc
agcaactattccaacagtgggcccgagcttcctctgaccgatggagggggtgtggcagac
ctcagtgccatcgatgaaaccccaatcatggactcgaccatttccacggcgaccacagcc
cttgctttgcaagccaggagaaacccagcagggaccaaatggatggagcacatcaaactt
gaaaggttaaaacaagtgaatggaatgtttccaagactgaaccctattctaccctccaaa
gcccctgcggtgtctcctctcataggaaatggcacacagtccaataacaactatagttca
ggtgggcccgggacccttctcccgagcagaggtgacctgtcgggtgtagacttcaccgtg
ctgaacacgctcaacaggagggacagcagcaccagcaccatcagctccgcctacctgagc
agccgaagatcctcgggcatctccccttgcttttccagccgcaggtccagcgaggcatcc
caggccgaagggcgaccccagaacgtgagtgtggccgactcttatgaccccatctccaca
gatgcctcacggaggtccagcgaggccagccagggggatgggctgcccagtctcctcagc
ctcacacccgtgcagcagtaccgcctcaaggccaagtatgccgctgccactggtggccca
ccgcccacacccctgccccacatggaaaggctgagcctaaagaccaggatggccctgcta
ggagaggggagggactcgggggtgaccctgcctccggtccatcctcctcggagatgtagt
gatggaggaggccatacgtacagccggcgtcacctgctgcctcatgatgcactggctaac
agtgtgaggagggccagcgaccctgtgaggacagtctcagagaacatgtcacttcccagg
gttcagcgcttcagcagcctcaacagctttaatcctccgagtttgcctccatcggtggag
aaacgtagcttagtgctgcaaaattatacccggccagagggcagccaggcccgattcttc
caagcgtctccttgtcctcccagcatcacagagaatgtcgccctggaggccctgaccatg
gatgctgatgccaacttgaatgatgaagatttcctgccagatgacgtagtacagtattta
aattcccagaaccaaacagagtatgggcagcaattacagagtgccatctctgaagatagc
aaagtagcccatgggccagagaacttggacctgccggatctgccagacagtcatgttggc
cagcagtatccggctctagagcagccttgttctgagggcagcaaaactgacttgcccatc
cagtggaatgaggtcagttctggaagctctgatctgtcatcctccaagctgaaatgtggc
cagcgcccgaccgttcagcaggctcgagcctttggcttatacaacaatatggtggcacac
ccacagaatctgtggaaggttggaactggccccaccggcggctgtcagatcctcggagag
aacggcagtacctacagtggtccagagcactttgtaatccacagtggggatgggcctggc
cccaatggaaacgcttttcatgaacagccctataagacgcagcagtacgggagccagatc
aacaggcagccactggcttccagtacactagatagcgcctgtggtgctgggcttcaaggg
gccaagctgaaaggcaacaccttgcaagagaacgggaatttgctagattttgccctgtcc
acggcaccaaatgagttagctggcaacacggtgaatggcataccagcccaagatccaatg
ggacagggatacattgctcatcagctactcagtggcagcatgcaacaccagggggccagc
cgccctggtcaacagatcctagggcaggttggtgctacctcacatgtcaacatctatcaa
gggacagagagctgcctgacggggactcaggacaacagcagccagccagcgagcatggcg
gtggtcaggggctaccagccctgtgctggctatgggggcagcaggcgccaggcaatgcca
aggggcagcctcactctgcaacaaggacagctcagcgacgtgagtcagagcagcagggtg
aacggcatcaagatggaggcacaagggcagtcccagcagctctgcgcgagcatgcagaat
tactcgggtcagttctatgaccagatcgcctcgggcttcagtcagcaagacaggaaggct
gcttcgttctccctttcagatgccaactgcctgctccaggggaacggcaccgaaaactct
gagttactttccccaggtgctaaccaagtgacaagcacagtggacagctttgagagtcat
gacctagaaggcgtgcagattgattttgatgccatcatcgatgatggggaccataccagc
ctaatgtcaggggccttgagcccaagtatcattcagaacctttcccacagctcctcccgt
ctcaccaccccacgggcacccctcccgttcccagccctgtccatgagcaccaccaacatg
gctatcggagatatgagttctttgctgacctcccttgcagaagaaagcaagttccttgca
gttatgcagtag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110561763
Entry
110561763         CDS       T05884                                 

Gene name
Gli1
Definition
(RefSeq) zinc finger protein GLI1 isoform X1
  KO
K16797  zinc finger protein GLI1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04024  cAMP signaling pathway
mun04340  Hedgehog signaling pathway
mun05200  Pathways in cancer
mun05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110561763 (Gli1)
   04024 cAMP signaling pathway
    110561763 (Gli1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110561763 (Gli1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110561763 (Gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110561763 (Gli1)
Transcription factors [BR:mun03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    110561763 (Gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 110561763
NCBI-ProteinID: XP_021513956
LinkDB
Position
Unknown
AA seq 1107 aa
MFNSMTPPQVNGYGEPCCLRPLPSQGVPSSGTEGLPGLPFCHQANFMSGPQGYGSARETN
GCTEGPLFPPPRSSVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPPPQTGHQKGTSPSYGVQPCVPHDSPRGGMMLHSQPRGPRPACQL
KSESDMMVGKCPEEPLEGNMSSPNSTGTQEHLLGMLDGREDLEREEKPEPESVYETDCRW
DGCSQEFDSQEQLVHHINSEHIHGERKEFVCRWGGCSRELRPFKAQYMLVVHMRRHTGEK
PHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEQEGCSKAFSNASDRAKHQNRTHSNE
KPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPPLSTVEPKRERE
GGGSIREDSRLTVPEGTMPQQSPGAQSSCSSEHSPAGSAANTDSGVELTGNAGGSTEDLS
SLDEGPCVTAPGLSTLHRLENLRLDQLHQLRPIGSRGLKLPSLTHAGAPVSRRLGPPVSL
DRRSSSSSSSFSSAYTVSRRSSLASPFPPGSPPETGASSLPGLTPAQHYMLRARHTSARA
DGTPPTTAQSLDRMAGLPVPPWRSRAEYPGYNPNAGVTRRASDPARAADHPAPARVQRFK
SLGCVHMLPSVAAGRNFEPHLPTSVYSPQAPSITENVAMDTRGLPEEPELGTSVMGNGLT
PCMDFSSVDALRYGAPEETAAEPYGARGPGSLPLGPGPPANYGPSHCSQQVSYPDPTPET
WGEFPSHSGVYPGTKAPSGGYSQCPRLEHYGQAQVKPEQGCPVGSGSAGLTPCLSAHPSE
GSPGPQPPFSHYPQPPPPQYPQLGPYPQPPHDYLSSETRPGLNFEPPSPSTGQIKAQLVC
NYVQSQQELLWEGRGRGGLPHQELPYQSPKFLGGSPGSQSSAKAPAAAYGSGFASALANH
KSGSYPTPSPCHETFEVGVNRPSHRPVAPPRLLPPLPPCYGPLKAGDANPSCGHPEVGRL
GAGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPLPSNEQGDSSKNTPPPSG
TPNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3324 nt   +upstreamnt  +downstreamnt
atgttcaactctatgactccaccgcaagtcaatggctatggtgagccatgctgtctccga
cccctccccagccaaggggtccccagctcgggaacagaaggacttcctggtttgcccttt
tgccaccaagccaactttatgtcagggccccagggttatgggtctgccagggagaccaac
ggctgcactgaggggccgctctttcctcctccccggagttcagtcaagttgacaaagaag
cgggcgctctccatctcaccgctttctgatgccagccttgatctgcaaacagttatccgc
acctcacccagctcccttgtggctttcatcaactcacgctgcacatctccaggagggtcc
tatggccacctctccattggcaccatgagcccgtctctaggcttcccaccaccgcagaca
ggtcaccaaaaaggaacctcgccttcctatggagtccagccctgtgttccacacgactct
cctcggggcggaatgatgcttcactctcagccccggggaccacgtccagcctgccagctc
aagtcagagtcggacatgatggtcggcaagtgtccagaggagcctttggagggaaacatg
tccagccccaactccacaggcacgcaggagcacctgctagggatgctggatgggcgggag
gacctggagagagaggagaaacctgagccggagtctgtgtatgagactgactgccgctgg
gatggctgcagtcaggagtttgattcccaggagcagctggtgcatcacatcaacagcgag
cacatccacggggagcggaaggagttcgtgtgccgctggggcggctgctcgcgggagctg
aggcccttcaaggcccagtacatgctggtggtgcacatgcgcagacacacgggggagaag
ccgcacaagtgcacgtttgaggggtgtcggaagtcgtactcacgtctagaaaacctgaag
acgcaccttcggtcgcacacgggtgagaagccttacatgtgtgagcaagaaggctgcagc
aaggccttcagcaacgccagcgaccgcgccaagcaccagaaccggacccactccaatgag
aagccgtacgtgtgcaagctccccggctgcaccaagcgctacaccgatcccagctcgctc
cgcaaacacgtcaagacggtgcacgggcctgatgcccacgtgaccaagcggcatcgaggc
gatggccccttgccgagggcgccgcccctctccacagtggagcccaagcgggaaagggaa
ggcggagggtccatcagggaagacagcagactgactgtgcccgagggaaccatgccacag
cagagcccgggagcgcagtcctcctgcagcagtgagcactccccagcaggcagcgcggcc
aacacagacagcggtgtggagctgactggcaacgcagggggcagcacggaggacctgtcc
agcctggatgaaggaccctgtgtcacggcccctgggctctccactctccatcgcctggag
aacctcaggctggatcagctgcatcagctccggccaataggatcccggggtctaaaactg
cccagcttaacccacgccggtgcgcctgtgtctcgccgtttaggccccccggtctccctt
gaccgccgcagcagcagcagctccagcagctttagctctgcttatacggtcagccgccgg
tcctccttggcatcccctttccctccgggatccccaccagagaccggggcctcatcgcta
cctggcctcacacctgcccagcactacatgctccgtgcaagacacacctcggccagggca
gacggtaccccacccaccacagctcagagcctggatcggatggccggtcttcctgtacct
ccttggagaagccgagctgagtacccaggatacaaccccaatgcaggggtcacccggagg
gccagtgacccagcccgggctgctgaccatcctgctccagccagagtccaacggttcaag
agtttgggatgtgtccacatgctccctagcgtggcagcagggcggaacttcgagccccac
ctccccacctctgtctactcaccacaggcccccagcatcactgaaaacgttgccatggac
acaagagggctaccggaggagccagagcttggaacttccgtgatgggcaatggcctgacc
ccatgcatggacttttcatctgtcgatgctctgagatatggggcccctgaggagacagcg
gctgagccgtatggagctaggggtccaggctccctgcctcttggacctggtccaccggcc
aactatggccctagccactgttcccagcaggtttcctatcctgaccccaccccagaaaca
tggggggaatttccttcccattctggggtataccctggcactaaggctccgagtggaggg
tatagccagtgtcctcgacttgaacactatggacaagcgcaggtgaagccggagcaaggg
tgcccagtggggtctggctctgctggattgacaccttgcctcagtgcccaccccagtgaa
gggtccccaggcccacaacctccattttcccattatccccagccccctcctccacagtat
ccccaattaggtccctatcctcagcctccccatgattatctttcatcagaaaccaggcct
ggcctcaactttgaacccccctctccttccacaggacaaatcaaagctcagctcgtgtgt
aattatgttcagtcacagcaggaattgttgtgggagggtagaggccggggaggactcccc
caccaggaacttccctatcagagccccaagtttctggggggttccccaggtagtcagagc
tctgcaaaagctccggcagctgcatacggatctggctttgcttctgctttggccaatcat
aagtcaggctcctatcctaccccttccccatgccatgaaacttttgaagtgggggtaaac
cggccttcccataggccggtagcaccgccccggcttctgcctccactgcccccttgctat
ggacccctcaaagcaggggatgccaaccctagctgtggccaccctgaagtgggcaggtta
ggagccggccctgccttgtaccctccccctgaagggcaggtgtgtaaccctctggattct
ctcgatctggacaacactcagctggactttgtggctattctagatgaggctcaggggctg
agtcctcttccttccaatgagcaaggggacagctctaaaaataccccacctccctctggg
actcccaatatggcagtgggtaacatgagtgtcttactggggtctctacctggagagaca
cagttcctcaactctagtgcctaa

DBGET integrated database retrieval system