KEGG   Meriones unguiculatus (Mongolian gerbil): 110546514
Entry
110546514         CDS       T05884                                 

Gene name
Ptch2
Definition
(RefSeq) protein patched homolog 2
  KO
K11101  patched 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun05200  Pathways in cancer
mun05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110546514 (Ptch2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110546514 (Ptch2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110546514 (Ptch2)
SSDB
Motif
Pfam: Patched Sterol-sensing MMPL
Other DBs
NCBI-GeneID: 110546514
NCBI-ProteinID: XP_021489052
LinkDB
Position
Unknown
AA seq 1182 aa
MVRPLSLGELPPSYTPPARASAPQILAGSLQAPLWLRAYFQGLLFSLGCKIQRHCGKVLF
LGLVAFGALALGLRVAIIETDLEQLWVEVDSRVSQELHYTKEKLGEEAAYTSQMLIQTAR
REGENVLTSEALSLHLQAALAASKVTVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPQQLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLDPGDQHCPPSAPNHLSRQAPNVARELSGGCHGFSHKFMHWQEELLLG
GTARDLQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQAGAVLQAWQRRFV
QLAQEALPANASQKIHAFSSTTLEDILRQFSEVSGARVAGGYLLMLAYACLTLLRWDCSQ
SQGAVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDIFLLAHAFTK
VPPDTPLPERMGECLRRTGTSVALTSINNMVAFFMAVLVPIPALRAFSLQAAIVVGCNLA
AVLLLFPAILSLDLRRRHRQRLDILCCFSSPCSAQVIQMLPQELGDRAVPVGTAHLTATV
QAFTHCEASSQHVVTILPPQAHLLSPTSDPLGSELYSPGGSTRDLLGQEDGTGTTVACRS
LLCAHWTLAHFARYQFAPLLLQTQAKALVLLFFGALLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRSWLQGIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGNAQEPLDFNQLT
TRKLVDKEGLIPPELFYVGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDATGENLRIP
AAQPLEFAQFPFLLHGLQKTADFVEAIEGARAACTEAGQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAVCVLLVCTFLVCAVLLLSPWTAGLIVLVLSMMTVELFGIMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTSQGSRNLRAARALEQTLAPVTDGAVSTLLGLLMLAGSS
FDFIIRYFFVVLTVLTLLGLLHGLLLLPVLLSILGPPPQVVQMYKESPQALHPAAPQGGG
LRWSMPPTLPQSFARVTTSMTVALHPPPLPGAYAHPASDEPT
NT seq 3549 nt   +upstreamnt  +downstreamnt
atggttcggccgctgtcccttggagagctgcctccaagctacacacctccagctcgggcc
tcagcacctcagatcctagctgggagcctgcaggctcctctctggcttcgtgcttacttc
caaggcctgctcttctccctggggtgcaagatccagagacactgtggcaaagtgctcttc
ctgggactggtggcctttggggctctagcactgggtctccgagtggccattattgagaca
gacctggaacagctctgggtagaagtggacagccgggtgagccaagagctgcattacacc
aaagagaagctgggggaggaggctgcctacacgtcccagatgctgattcagactgcacgc
cgggagggggaaaacgtcctcacctccgaggccctcagccttcaccttcaggcagcactc
gcagccagtaaagtaacagtgtcactttatgggaagtcctgggatttgaacaaaatctgc
tacaaatcaggggttccccttattgaaaatggaatgattgagcggatgattgagaagctg
ttcccgtgtgtgatcctcaccccccttgactgcttctgggagggagccaaactccagggg
ggctccgcctacctgccgggccgccccgatatccagtggaccaacctggacccccagcag
ctgctggaggagctgggccccttcgcctccctggagggcttccgggagctgctcgacaag
gcacaggtgggccaggcctatgtgggacgaccctgcctggaccccggtgaccagcactgc
ccacctagtgcccctaaccatctcagcaggcaggcccccaatgtggcccgagaactgagt
gggggctgccacggcttctcccacaagttcatgcactggcaagaggaactgctcctggga
ggcacagccagagatctccaaggacagctgctgagggccgaggccttgcagagcaccttc
ctgctgatgagtccccggcagctgtatgagcacttccggggcgactaccagacacatgac
atcggctggagcgaggagcaggccggcgcggtgctgcaggcctggcagaggcgctttgtg
cagctagcccaggaggctctgcctgccaacgcctcgcagaagatccacgccttctcctcc
accaccctggaggacatactgcgccagttctctgaagtcagcggggcccgcgtggcaggc
ggctatctgctcatgctggcctacgcctgcctaaccctgctccggtgggactgctcccag
tcccagggcgccgtgggtctcgccggggtgttgttggtggccctggcagtggcctcaggc
cttgggctttgtgcccttcttggcatcactttcaatgctgcgaccactcaggtgctgccc
ttcctggctctgggcatcggcgtggatgacattttcctgctggctcatgcctttacaaag
gtcccacctgacacccctctcccagagcggatgggcgagtgcctgagacgcacaggcacc
agtgtggcgctcacctccatcaacaacatggttgccttcttcatggctgtcctggttccc
atcccggccctgcgggctttctccctgcaggcagccatagtggtgggctgcaacctggca
gcagtcctgcttctcttccctgccatcctcagcctcgacctgcgccggcgccaccgccag
cgcctcgacattctctgctgcttttccagcccctgctctgctcaggtcattcagatgctg
ccccaagagctaggagacagagcagtaccggtgggcactgcccacctgactgccaccgtg
caggcatttacccactgcgaagccagcagccagcacgtcgtcaccattttgcctcctcaa
gcccacctgctgtctccgacttctgacccactgggctctgaactctacagccctggaggg
tccacacgggaccttctaggccaagaggacgggacagggacaacagtggcctgcaggtcc
ctgctctgtgcccactggactcttgcccattttgcccgctatcagtttgcgcccttactg
ctccagacacaagccaaggccctggtgcttctcttcttcggggcacttttaggcctgagt
ctctatggagccaccttggtgcaagacgggctggccttgacagatgtggtacctcggggc
accaaggaacatgccttcctgagcgcccagctcaggtacttctccctgtacgaggtggcc
ctggtgacacagggtggctttgactacgcccactcccaacgcgccctctttgatctgcac
cagcgcttcagttccctcaaggctgtgctgcccccccctgccacccaggcaccccgcacc
tggctgcattactaccgcagctggctacaaggtatccaggctgcgtttgaccaggactgg
gcttctggacgtattacccgccactcttaccgcaatggctctgaagatggcgccctggcc
tacaagctgctcatccaaaccgggaatgcccaggagcctctggatttcaaccagctgacc
acaaggaaactggtggacaaggagggactgatcccaccagaactcttctacgtggggctg
actgtgtgggtgagcagtgaccccctgggcctagcagcctcccaggccaacttctacccc
ccacctcccgaatggctgcacgacaaatacgatgccactggggagaaccttcgcatccct
gcagcccagcctttggagtttgcccagttccccttcctgctgcatggactccagaagact
gcagacttcgtagaagccatcgaaggggcccgggcagcatgcactgaggccggccaggcg
ggggtgcacgcctaccccagcggctcccccttcctcttctgggagcagtatctgggtctt
cggcgctgcttcctgttggcggtctgcgtcttgctcgtgtgcaccttccttgtctgtgct
gtgctgctgctcagcccgtggacggctggcctcatagtgctggtcctgtccatgatgact
gtggagctctttggtatcatgggattcctgggcatcaagctgagtgccatccccgtggtg
atccttgtggcctctgtaggcattggtgttgaattcacagtccacgttgcactgggcttc
ctgaccagccagggtagccggaacctgcgggcagctcgagctctagagcaaacactcgcc
cctgtgacggatggcgctgtctccacgttgctgggtctgctcatgcttgctggctccagc
tttgacttcatcataaggtacttctttgtggtgctgacagtgctgaccctcttgggcctg
ctccatggactcctgctgctgcccgtactgctctccatcctaggccccccaccacaggtg
gttcagatgtacaaggagagcccacaggccctacaccctgcggctccacagggaggcggg
ctcaggtggagcatgcctcccaccctgccccagagttttgccagagtgactacctctatg
actgtggcccttcacccaccaccactgcctggagcctacgcccacccagcctccgatgag
cccacgtag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110551759
Entry
110551759         CDS       T05884                                 

Gene name
Ptch1
Definition
(RefSeq) protein patched homolog 1 isoform X1
  KO
K06225  patched 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04024  cAMP signaling pathway
mun04340  Hedgehog signaling pathway
mun04360  Axon guidance
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110551759 (Ptch1)
   04024 cAMP signaling pathway
    110551759 (Ptch1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110551759 (Ptch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110551759 (Ptch1)
   05205 Proteoglycans in cancer
    110551759 (Ptch1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110551759 (Ptch1)
SSDB
Motif
Pfam: Patched Sterol-sensing MENTAL
Other DBs
NCBI-GeneID: 110551759
NCBI-ProteinID: XP_021498214
LinkDB
Position
Unknown
AA seq 1452 aa
MARRPPTPRAMDLLNRNRLVIVSPRRTPPKACGGPARRGFYTFRSFCKDGGGGEDEDEDG
GERDGDRADKETRGDRGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGA
FAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLT
TEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITP
LDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLDKAEVGHGY
MDRPCLNPADPDCPATAPNKNSTKPLDVALVLNGGCQGLSRKYMHWQEELIVGGTVKNAS
GKLVSAHALQTMFQLMTPKQMYEHFRGYDYVSHINWNEDRAAAILEAWQRTYVEVVHQSV
APNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGL
AGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRI
PFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLI
FPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTEPHSNTRYSPPPPYSSHSFA
HETHITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDL
LSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLRPKAKAVVILLFLVLLGVSLYGTTRV
RDGLDLTDIVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSNVKY
VMLEENKQLPQMWLHYFRDWLQGLQDAFDSDWETGRIMPNNYKNGSDDGVLAYKLLVQTG
SRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHD
KADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRIICNNYTSLGLASYPN
GYPFLFWEQYISLRHWLLLAISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMM
GLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDKNHRAMLALEHMFAPVLDGAV
STLLGVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSFFGPCPEVSPANGLN
RLPTPSPEPPPSVVRFAVPPGHMNNGSDSSDSEYSSQTTVSGISEELRHYEAQRGAGGPA
HQVIVEATENPVFARSTVVHPESRHHPPLNPRQSHLDSDSLSSGRQGQQPRREPPREGLR
PPPYRPRRDAFEISTEGHSGPSNRDRSGPRGARSHNPRNPTSTATGSSVPSYCQPITTVT
ASASVTVAVHPPPGPGRNPRGGPYPGYETDHGVFEDPHVPFHVRCERRGSKVEVIELQDV
ECEERPWGSSSD
NT seq 4359 nt   +upstreamnt  +downstreamnt
atggcgcggagaccacccacgccgagggccatggacctgcttaatagaaacaggcttgta
attgtgagtccgcgccgcactccgccgaaagcctgcggcggccccgcgcgccggggtttt
tacactttccgttccttttgtaaagacggaggaggaggagaagacgaagacgaagacggg
ggggaaagagacggcgacagggcagacaaagagacccgcggcgacagggggaaggctact
ggccggaaagcgccgctgtggctgagagcgaagtttcagagactgttatttaaactgggt
tgttacattcaaaagaactgcggcaagtttttggttgtgggtctcctcatatttggggcc
ttcgctgtgggattaaaggcagctaatctcgagaccaacgtggaggagctgtgggtggaa
gttggtggacgagtgagtcgagaattaaattatacccgccagaagatcggagaggaggcc
atgtttaatcctcaactcatgatacagactccgaaagaagaaggtgctaacgtcctgacc
acagaggcgctcctgcagcacctggactcggcactccaggccagccgtgtgcacgtctat
atgtataacaggcaatggaagttggaacatttgtgctacaaatcaggggaacttatcaca
gaaacaggttacatggatcagataatagaatacctttacccttgcttaatcattacacct
ttggactgcttctgggaaggagcaaagttacagtcggggacagcatacctcctaggtaag
cctcctttacggtggacaaactttgaccccttggaattcctcgaagagttaaagaaaata
aactaccaagtggacagttgggaggaaatgctggataaagctgaagttggccatgggtac
atggaccggccctgccttaacccagccgacccggactgccctgccacagcccccaacaaa
aattcaaccaaacctcttgatgtggcccttgttttgaatggtggatgtcaaggtttatcc
aggaagtacatgcattggcaggaggagttgattgtgggtggcacagtcaagaatgcctct
ggaaaactcgtcagtgctcacgccctgcagaccatgttccagttaatgacgcccaagcaa
atgtatgaacacttcaggggctacgactacgtctctcacatcaactggaacgaggacagg
gcggcagccatcctggaggcgtggcagaggacctatgtggaggtggttcatcaaagtgtt
gccccaaactccactcaaaaggtgctttccttcaccaccacgaccctggatgacatccta
aagtccttctctgatgtcagtgtcattcgagtggccagcggctacctgctgatgcttgcc
tatgcctgtttaaccatgctgcgctgggactgctccaagtcccagggtgccgtggggctg
gctggtgtcctgctggttgcattgtcagtggctgcaggactgggcctctgctccctgatc
gggatttcctttaatgctgcgacaactcaggttttgccatttcttgctcttggtgttggt
gtggacgacgtctttctcctggcacatgcgttcagtgaaacaggacagaataaaaggatt
ccatttgaggacaggaccggggagtgcctcaagcgcacaggagccagcgtggcccttacc
tccatcagcaatgtcactgccttcttcatggctgcgttaatccctattcctgcgctgcgc
gccttctccctccaggctgctgtggttgtggtattcaattttgccatggtgcttctcatt
ttccctgcaattctcagcatggatttatacagacgtgaggacagaagattggacattttc
tgctgtttcacaagcccctgtgtcagcagggtgattcaggtcgagccacaggcctacacg
gagcctcacagtaacacccgttacagccccccacccccctacagcagtcatagcttcgcc
cacgaaacacacatcaccatgcagtccactgtccagcttcgcacagagtacgaccctcac
acacacgtgtactacaccaccgctgagccgcgctcggagatctctgtccagcccgtcacc
gtcacccaggacactctcagctgccagagtcctgagagcaccagctccacccgggacctg
ctttcccagttctcggactccagcctccactgccttgagcctccctgcaccaagtggaca
ctctcctcatttgctgagaagcattatgcacctttcctcttgagacccaaagccaaggct
gtggtaatcctccttttcctggtcttgctgggggtcagcctttacgggaccacccgagtg
agagacggactggacctcacggacattgtcccccgggaaaccagagaatatgacttcata
gctgcacagttcaaatatttttctttctacaatatgtatatagttacccagaaagcagac
tacccaaatatccaacacctactttacgaccttcataagagtttcagcaatgtgaagtat
gtcatgctggaggagaacaagcaacttccccaaatgtggctgcactacttcagagactgg
ctccaagggcttcaggatgcatttgacagtgactgggaaactgggaggatcatgccaaac
aattacaaaaatggatcggatgacggggtccttgcctacaaactcctggtacagactggc
agccgagacaagcccatcgacattagtcagttgactaaacagcgtctggtggatgcagat
ggcatcattaatcccagcgctttctacatctacctgacggcttgggtcagcaacgacccc
gtagcttacgctgcctcccaggccaacatccggccgcaccgaccagagtgggtccacgac
aaagccgactacatgccagagaccagactgagaataccagcagcagagcccatcgaatac
gctcagttccctttctacctcaacggcctacgagacacctcagactttgtggaagccatt
gaaaaagtgagaatcatctgtaacaactacacaagtctgggactggccagctaccccaat
ggctaccccttcctgttctgggagcagtacatcagtctgcgccactggctgctgctagcc
atcagcgtggtactggcctgcacgtttctggtgtgcgcagtcttcctgctgaacccctgg
acggctgggatcattgtcatggtcctggctctgatgaccgttgagctcttcggcatgatg
ggcctcattgggatcaagctgagtgctgtacctgtggtcatcctgattgcgtccgtcggc
attggagtggagttcaccgttcacgtggccttggcctttctgacagccattggtgacaag
aaccacagggctatgcttgccctggagcacatgtttgctcctgttctggacggcgctgtg
tccactcttctgggggtactaatgcttgcagggtccgaatttgacttcattgtcagatac
ttctttgccgtcctggctattctcaccgtcctgggggttctcaatggactggttttgctg
cccgtactcttgtccttctttggaccatgtcctgaggtgtctccagccaatggcctaaac
cggctgcccaccccttcacctgagccgcccccgagtgtcgtcaggtttgcggtgcctccc
ggtcacatgaacaatgggtctgattcctccgactccgagtacagctctcagaccacggtg
tctggcattagtgaagagctcaggcactacgaagcacagcggggtgctggaggtcctgcc
caccaagtgattgtggaagccacagaaaaccccgtcttcgcccggtccactgtggtccat
ccagaatccagacatcatcctcccttgaaccctcggcagtcccacctggactctgactcc
ttgtcctctggacggcaaggccagcagcctcgaagggagccccccagagaaggcttgcgg
ccacctccctacagaccgcgcagagacgcttttgaaatttctactgaagggcattccggc
cctagcaatagggaccgctcaggcccccgtggggcccgttcccacaaccctcggaacccg
acatccaccgccacgggcagctctgtgcccagctactgccagcccatcaccactgtgaca
gcttctgcttctgtgactgtcgctgtgcaccctccacctgggcctgggcgcaaccctaga
ggggggccctatccgggttatgagactgaccacggggtgttcgaggacccccatgtgcct
ttccatgtcaggtgtgagaggaggggctcgaaggtggaggtcatagagctgcaggacgtg
gaatgtgaggagaggccgtgggggagcagctccgactga

DBGET integrated database retrieval system