KEGG   Meriones unguiculatus (Mongolian gerbil): 110546525
Entry
110546525         CDS       T05884                                 

Gene name
Akr1a1
Definition
(RefSeq) alcohol dehydrogenase [NADP(+)]
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00010  Glycolysis / Gluconeogenesis
mun00040  Pentose and glucuronate interconversions
mun00053  Ascorbate and aldarate metabolism
mun00561  Glycerolipid metabolism
mun01100  Metabolic pathways
mun01240  Biosynthesis of cofactors
Module
mun_M00014  Glucuronate pathway (uronate pathway)
mun_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110546525 (Akr1a1)
   00040 Pentose and glucuronate interconversions
    110546525 (Akr1a1)
   00053 Ascorbate and aldarate metabolism
    110546525 (Akr1a1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    110546525 (Akr1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110546525 (Akr1a1)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     110546525 (Akr1a1)
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110546525 (Akr1a1)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 110546525
NCBI-ProteinID: XP_021489076
LinkDB
Position
Unknown
AA seq 324 aa
MASCVLLHTGQNMPLIGLGTWKSEPGQVKAAIKYALSAGYRHIDCAAVYGNESEIGEALK
ENVGPGKAVPREELFVTSKLWNTKHHPEDVEAAVRKTLADLQLEYLDLYLMHWPYAFERG
DNLFPKNADETIRYDSIHYKETWKAMEALVAKGLVRALGLSNFSSRQIDDILSVASVRPA
VLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSPDRAWHHPDEPVLLEEPVVLALAEKH
GRSPAQILLRWQVQRKVICIPKSITPSRILQNIQVFDFTLSPEEMKQLDALNKNWRYIVP
MITVDGKRVPRDAGHPLYPFNDPY
NT seq 975 nt   +upstreamnt  +downstreamnt
atggcttcctgtgtccttttgcacactggacagaacatgcctctcattgggctggggaca
tggaagagtgagccggggcaggtaaaggcagccattaaatacgccctcagtgcaggctac
cgccacattgattgtgctgctgtctatggcaacgagagtgagattggagaggccctgaag
gagaatgtgggaccaggcaaggcagtgcctcgagaggagctgtttgtgacatccaagctg
tggaatactaagcaccaccccgaggatgtagaagctgccgtccggaagacactggctgat
ctccagctggagtacctggacctctatttgatgcactggccttacgcctttgagcgggga
gacaacctctttcccaagaacgctgatgaaactatccgctatgactccatccactataag
gagacgtggaaggctatggaggctctggtggcaaaggggctggtgagagccctgggcttg
tccaacttcagcagtcggcagattgatgacatcctcagtgtggcctctgtgcgcccagct
gtcttgcaggtggaatgccatccatacctggctcaaaatgagctcattgcccactgtcaa
gctcgaggcttggaagtaactgcttacagcccattgggttcccctgatcgtgcttggcac
caccctgatgagccagtcctgcttgaggaaccagtggtcttggcactagctgaaaaacat
ggcagatctccagctcaaatcttgctcagatggcaggttcagcggaaagtaatctgcatc
cccaaaagcatcactccttcacgaatccttcagaacattcaggtatttgatttcacctta
agcccagaggaaatgaagcaattagatgctctgaacaaaaattggcggtatattgtgccc
atgattacggtggatgggaagagggttcccagagatgccggacatcccctgtatcccttt
aatgacccgtactga

DBGET integrated database retrieval system