KEGG   Meriones unguiculatus (Mongolian gerbil): 110546562
Entry
110546562         CDS       T05884                                 

Gene name
Mapk14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04010  MAPK signaling pathway
mun04015  Rap1 signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04114  Oocyte meiosis
mun04218  Cellular senescence
mun04261  Adrenergic signaling in cardiomyocytes
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04714  Thermogenesis
mun04722  Neurotrophin signaling pathway
mun04723  Retrograde endocannabinoid signaling
mun04728  Dopaminergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04912  GnRH signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04917  Prolactin signaling pathway
mun04926  Relaxin signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun05014  Amyotrophic lateral sclerosis
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05205  Proteoglycans in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110546562 (Mapk14)
   04015 Rap1 signaling pathway
    110546562 (Mapk14)
   04370 VEGF signaling pathway
    110546562 (Mapk14)
   04668 TNF signaling pathway
    110546562 (Mapk14)
   04068 FoxO signaling pathway
    110546562 (Mapk14)
   04071 Sphingolipid signaling pathway
    110546562 (Mapk14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110546562 (Mapk14)
   04218 Cellular senescence
    110546562 (Mapk14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110546562 (Mapk14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110546562 (Mapk14)
   04613 Neutrophil extracellular trap formation
    110546562 (Mapk14)
   04620 Toll-like receptor signaling pathway
    110546562 (Mapk14)
   04621 NOD-like receptor signaling pathway
    110546562 (Mapk14)
   04622 RIG-I-like receptor signaling pathway
    110546562 (Mapk14)
   04625 C-type lectin receptor signaling pathway
    110546562 (Mapk14)
   04660 T cell receptor signaling pathway
    110546562 (Mapk14)
   04658 Th1 and Th2 cell differentiation
    110546562 (Mapk14)
   04659 Th17 cell differentiation
    110546562 (Mapk14)
   04657 IL-17 signaling pathway
    110546562 (Mapk14)
   04664 Fc epsilon RI signaling pathway
    110546562 (Mapk14)
   04670 Leukocyte transendothelial migration
    110546562 (Mapk14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110546562 (Mapk14)
   04914 Progesterone-mediated oocyte maturation
    110546562 (Mapk14)
   04917 Prolactin signaling pathway
    110546562 (Mapk14)
   04926 Relaxin signaling pathway
    110546562 (Mapk14)
   04935 Growth hormone synthesis, secretion and action
    110546562 (Mapk14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110546562 (Mapk14)
  09156 Nervous system
   04728 Dopaminergic synapse
    110546562 (Mapk14)
   04723 Retrograde endocannabinoid signaling
    110546562 (Mapk14)
   04722 Neurotrophin signaling pathway
    110546562 (Mapk14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110546562 (Mapk14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110546562 (Mapk14)
  09159 Environmental adaptation
   04714 Thermogenesis
    110546562 (Mapk14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110546562 (Mapk14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110546562 (Mapk14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110546562 (Mapk14)
   05020 Prion disease
    110546562 (Mapk14)
   05022 Pathways of neurodegeneration - multiple diseases
    110546562 (Mapk14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110546562 (Mapk14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110546562 (Mapk14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110546562 (Mapk14)
   05135 Yersinia infection
    110546562 (Mapk14)
   05133 Pertussis
    110546562 (Mapk14)
   05152 Tuberculosis
    110546562 (Mapk14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110546562 (Mapk14)
   05161 Hepatitis B
    110546562 (Mapk14)
   05171 Coronavirus disease - COVID-19
    110546562 (Mapk14)
   05163 Human cytomegalovirus infection
    110546562 (Mapk14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110546562 (Mapk14)
   05169 Epstein-Barr virus infection
    110546562 (Mapk14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110546562 (Mapk14)
   05140 Leishmaniasis
    110546562 (Mapk14)
   05142 Chagas disease
    110546562 (Mapk14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110546562 (Mapk14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110546562 (Mapk14)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110546562 (Mapk14)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110546562 (Mapk14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 110546562
NCBI-ProteinID: XP_021489110
LinkDB
Position
Unknown
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg
cccgagcgctaccagaacctgtccccggtgggctcgggcgcctacggctcggtgtgtgct
gcttttgatacaaagacggggcatcgtgtggctgttaagaagctgtcgaggccatttcag
tccattattcatgccaaaagaacctacagggagctgcgcctgctgaagcacatgaagcac
gagaacgtgattgggctgttggatgtgttcacacccgcaaggtcgctggaggagttcaac
gatgtgtacctggtgactcacctcatgggggcagacctgaacaacatcgtgaagtgccag
aagctcacggatgaccacgtgcagttcctcatataccagatcctccgtgggctgaagtat
atacactcagctgacataattcacagggacctaaagcccagcaacctagctgtgaacgaa
gactgtgagctgaagatcctggattttgggctggctcggcacaccgatgatgagatgaca
ggctacgtggctaccaggtggtaccgggctcctgagatcatgctcaactggatgcactac
aaccagacagtggatatttggtccgtgggctgcatcatggctgagctgttgaccggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
acccccggggctgagcttctgaagaaaatctcctcagagtctgcaagaaactacattcag
tctctggcccagatgccgaagatgaacttcgcaaatgtatttattggtgccaatcccctg
gctgtggaccttctggagaagatgctcgttctggactcggataagaggatcacggcagcg
caggctcttgcacacgcctactttgcgcagtaccacgaccccgatgacgagcctgtggcc
gacccttacgaccagtcctttgagagcagggacctccttatagatgagtggaagagcctg
acctacgatgaagtcatcagctttgtgcctccgccccttgaccaagaagaaatggagtcg
tga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110546585
Entry
110546585         CDS       T05884                                 

Gene name
Mapk13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04010  MAPK signaling pathway
mun04015  Rap1 signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04114  Oocyte meiosis
mun04218  Cellular senescence
mun04261  Adrenergic signaling in cardiomyocytes
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04714  Thermogenesis
mun04722  Neurotrophin signaling pathway
mun04723  Retrograde endocannabinoid signaling
mun04728  Dopaminergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04912  GnRH signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04917  Prolactin signaling pathway
mun04926  Relaxin signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun05014  Amyotrophic lateral sclerosis
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05205  Proteoglycans in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110546585 (Mapk13)
   04015 Rap1 signaling pathway
    110546585 (Mapk13)
   04370 VEGF signaling pathway
    110546585 (Mapk13)
   04668 TNF signaling pathway
    110546585 (Mapk13)
   04068 FoxO signaling pathway
    110546585 (Mapk13)
   04071 Sphingolipid signaling pathway
    110546585 (Mapk13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110546585 (Mapk13)
   04218 Cellular senescence
    110546585 (Mapk13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110546585 (Mapk13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110546585 (Mapk13)
   04613 Neutrophil extracellular trap formation
    110546585 (Mapk13)
   04620 Toll-like receptor signaling pathway
    110546585 (Mapk13)
   04621 NOD-like receptor signaling pathway
    110546585 (Mapk13)
   04622 RIG-I-like receptor signaling pathway
    110546585 (Mapk13)
   04625 C-type lectin receptor signaling pathway
    110546585 (Mapk13)
   04660 T cell receptor signaling pathway
    110546585 (Mapk13)
   04658 Th1 and Th2 cell differentiation
    110546585 (Mapk13)
   04659 Th17 cell differentiation
    110546585 (Mapk13)
   04657 IL-17 signaling pathway
    110546585 (Mapk13)
   04664 Fc epsilon RI signaling pathway
    110546585 (Mapk13)
   04670 Leukocyte transendothelial migration
    110546585 (Mapk13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110546585 (Mapk13)
   04914 Progesterone-mediated oocyte maturation
    110546585 (Mapk13)
   04917 Prolactin signaling pathway
    110546585 (Mapk13)
   04926 Relaxin signaling pathway
    110546585 (Mapk13)
   04935 Growth hormone synthesis, secretion and action
    110546585 (Mapk13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110546585 (Mapk13)
  09156 Nervous system
   04728 Dopaminergic synapse
    110546585 (Mapk13)
   04723 Retrograde endocannabinoid signaling
    110546585 (Mapk13)
   04722 Neurotrophin signaling pathway
    110546585 (Mapk13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110546585 (Mapk13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110546585 (Mapk13)
  09159 Environmental adaptation
   04714 Thermogenesis
    110546585 (Mapk13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110546585 (Mapk13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110546585 (Mapk13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110546585 (Mapk13)
   05020 Prion disease
    110546585 (Mapk13)
   05022 Pathways of neurodegeneration - multiple diseases
    110546585 (Mapk13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110546585 (Mapk13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110546585 (Mapk13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110546585 (Mapk13)
   05135 Yersinia infection
    110546585 (Mapk13)
   05133 Pertussis
    110546585 (Mapk13)
   05152 Tuberculosis
    110546585 (Mapk13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110546585 (Mapk13)
   05161 Hepatitis B
    110546585 (Mapk13)
   05171 Coronavirus disease - COVID-19
    110546585 (Mapk13)
   05163 Human cytomegalovirus infection
    110546585 (Mapk13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110546585 (Mapk13)
   05169 Epstein-Barr virus infection
    110546585 (Mapk13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110546585 (Mapk13)
   05140 Leishmaniasis
    110546585 (Mapk13)
   05142 Chagas disease
    110546585 (Mapk13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110546585 (Mapk13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110546585 (Mapk13)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110546585 (Mapk13)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110546585 (Mapk13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 110546585
NCBI-ProteinID: XP_021489157
LinkDB
Position
Unknown
AA seq 366 aa
MSLTRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSATDKRTGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMHHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKLMGM
EFSEDKVQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADPEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAADLLDRMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQQPLDDSLEHEKLTVDEWKQHIYKEIQNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcctcacccggaagaggggcttctacaagcaggacatcaacaagacggcctgggag
ctccccaagacctacctggcgcccgcgcacgtcggcagcggggcctatggcgcggtgtgc
tcggccactgacaagcggacgggggagaaggtggccatcaagaagctgagccggcccttc
cagtcggagatcttcgccaagcgagcctaccgcgagctcctgctgctgaagcacatgcac
catgagaacgtcatcgggctcctggacgtcttcaccccggcctcttcccttcggaacttc
catgatttctacctggtgatgcccttcatgcagacggacctgcagaagctcatggggatg
gagttcagtgaggacaaggtccagtacctggtataccagatgcttaaaggtctaaagtac
atccactctgccggtgttgtccacagggacctgaagccgggcaacctggcggtgaacgaa
gactgtgagctgaagatcctggacttcgggctggcgcggcatgcggaccccgagatgacc
gggtacgtggtgacccgctggtacagggcccccgaggtgattctcagctggatgcattac
aaccagacagtggacatctggtccgttggctgcatcatggcggagatgctgaccggcaag
acgctgttcaagggaaaggactacctggaccagctgacccagattctgaaggtgactggg
gtgccgggtgctgagtttgtgcagaagctgaaagacaaggcggccaaatcctacatccag
tctctgccccagagccccaagaaggatttcacccagctcttcccacgtgccagcccccag
gctgcggacctgctggacaggatgctggagctggacgtggacaagcgcctgaccgccgcc
caggcactcgctcaccccttctttgagcccttccgggaccccgaggaggagacagaggcc
cagcagccacttgatgattccttagaacacgagaagctcactgtggatgagtggaaacaa
cacatctacaaagagatccagaacttcagccccatagcccggaaggactctcgccgaaga
agtggcatgaagctgcagtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110549673
Entry
110549673         CDS       T05884                                 

Gene name
Mapk12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04010  MAPK signaling pathway
mun04015  Rap1 signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04114  Oocyte meiosis
mun04218  Cellular senescence
mun04261  Adrenergic signaling in cardiomyocytes
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04714  Thermogenesis
mun04722  Neurotrophin signaling pathway
mun04723  Retrograde endocannabinoid signaling
mun04728  Dopaminergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04912  GnRH signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04917  Prolactin signaling pathway
mun04926  Relaxin signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun05014  Amyotrophic lateral sclerosis
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05205  Proteoglycans in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110549673 (Mapk12)
   04015 Rap1 signaling pathway
    110549673 (Mapk12)
   04370 VEGF signaling pathway
    110549673 (Mapk12)
   04668 TNF signaling pathway
    110549673 (Mapk12)
   04068 FoxO signaling pathway
    110549673 (Mapk12)
   04071 Sphingolipid signaling pathway
    110549673 (Mapk12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110549673 (Mapk12)
   04218 Cellular senescence
    110549673 (Mapk12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110549673 (Mapk12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110549673 (Mapk12)
   04613 Neutrophil extracellular trap formation
    110549673 (Mapk12)
   04620 Toll-like receptor signaling pathway
    110549673 (Mapk12)
   04621 NOD-like receptor signaling pathway
    110549673 (Mapk12)
   04622 RIG-I-like receptor signaling pathway
    110549673 (Mapk12)
   04625 C-type lectin receptor signaling pathway
    110549673 (Mapk12)
   04660 T cell receptor signaling pathway
    110549673 (Mapk12)
   04658 Th1 and Th2 cell differentiation
    110549673 (Mapk12)
   04659 Th17 cell differentiation
    110549673 (Mapk12)
   04657 IL-17 signaling pathway
    110549673 (Mapk12)
   04664 Fc epsilon RI signaling pathway
    110549673 (Mapk12)
   04670 Leukocyte transendothelial migration
    110549673 (Mapk12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110549673 (Mapk12)
   04914 Progesterone-mediated oocyte maturation
    110549673 (Mapk12)
   04917 Prolactin signaling pathway
    110549673 (Mapk12)
   04926 Relaxin signaling pathway
    110549673 (Mapk12)
   04935 Growth hormone synthesis, secretion and action
    110549673 (Mapk12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110549673 (Mapk12)
  09156 Nervous system
   04728 Dopaminergic synapse
    110549673 (Mapk12)
   04723 Retrograde endocannabinoid signaling
    110549673 (Mapk12)
   04722 Neurotrophin signaling pathway
    110549673 (Mapk12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110549673 (Mapk12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110549673 (Mapk12)
  09159 Environmental adaptation
   04714 Thermogenesis
    110549673 (Mapk12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110549673 (Mapk12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110549673 (Mapk12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110549673 (Mapk12)
   05020 Prion disease
    110549673 (Mapk12)
   05022 Pathways of neurodegeneration - multiple diseases
    110549673 (Mapk12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110549673 (Mapk12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110549673 (Mapk12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110549673 (Mapk12)
   05135 Yersinia infection
    110549673 (Mapk12)
   05133 Pertussis
    110549673 (Mapk12)
   05152 Tuberculosis
    110549673 (Mapk12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110549673 (Mapk12)
   05161 Hepatitis B
    110549673 (Mapk12)
   05171 Coronavirus disease - COVID-19
    110549673 (Mapk12)
   05163 Human cytomegalovirus infection
    110549673 (Mapk12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110549673 (Mapk12)
   05169 Epstein-Barr virus infection
    110549673 (Mapk12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110549673 (Mapk12)
   05140 Leishmaniasis
    110549673 (Mapk12)
   05142 Chagas disease
    110549673 (Mapk12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110549673 (Mapk12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110549673 (Mapk12)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110549673 (Mapk12)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110549673 (Mapk12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo UvrD_C Kinase-like
Other DBs
NCBI-GeneID: 110549673
NCBI-ProteinID: XP_021494632
LinkDB
Position
Unknown
AA seq 367 aa
MGSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGSKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK
VTGTPPPEFVQKLQSAEAKDYMEGLPELEKKDFASILTNASPQAVSLLEKMLVLDAEQRV
TAAEALAHPYFESLRDTEDEPKVQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR
VPKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgggatccccgccacccgcccgtaagggcttttaccgccaggaggtgaccaaaacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagccagttggctctggtgcctatggtgca
gtgtgctctgcggtagacagccgcactggcagcaaggtggcaatcaagaagttgtaccgg
cccttccagtcggagctgtttgccaagcgcgcctacagagagctgcgcctcctcaaacac
atgcgccacgagaacgtcatcgggctgctggatgtgttcactcctgatgagactctggat
gacttcacagacttctacctggtgatgccattcatgggcactgatctgggcaagctcatg
aagcacgagactctgagtgaagacagaatccagtttcttgtgtatcagatgctgaagggg
ctgaagtacatccatgctgctggtgtcatccacagagacttgaagcctggcaaccttgct
gtgaatgaggactgtgagctgaagatcttagacttcggccttgccagacaggcagacagt
gagatgacgggatatgtggtgactcggtggtaccgggcaccagaggtcatcttgaattgg
atgcgctacacacagacagtggacatttggtctgttggctgcatcatggcggagatgatt
actggaaagattctgttcaaaggcaatgaccacctggaccagctgaaggagatcatgaag
gtcacagggacgccccctcccgagtttgtacagaagttacagagtgctgaggccaaagac
tacatggaaggcctccctgagctggaaaagaaagattttgcctccatcctgaccaacgca
agtcctcaggctgtgagcctcctggaaaagatgctggtgctagatgcagaacagcgggtg
acagcagctgaggcgttagcccacccatactttgagtcccttcgggacactgaggatgag
cccaaggtccagaaatatgatgactcctttgatgatgtagaccgcacccttgaagagtgg
aagcgtgttacttacaaggaagtgctcagcttcaagcctcccaggcagctaggagccaga
gttccaaaggagacagctctatga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110549680
Entry
110549680         CDS       T05884                                 

Gene name
Mapk11
Definition
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04010  MAPK signaling pathway
mun04015  Rap1 signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04114  Oocyte meiosis
mun04218  Cellular senescence
mun04261  Adrenergic signaling in cardiomyocytes
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04714  Thermogenesis
mun04722  Neurotrophin signaling pathway
mun04723  Retrograde endocannabinoid signaling
mun04728  Dopaminergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04912  GnRH signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04917  Prolactin signaling pathway
mun04926  Relaxin signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun05014  Amyotrophic lateral sclerosis
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05205  Proteoglycans in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110549680 (Mapk11)
   04015 Rap1 signaling pathway
    110549680 (Mapk11)
   04370 VEGF signaling pathway
    110549680 (Mapk11)
   04668 TNF signaling pathway
    110549680 (Mapk11)
   04068 FoxO signaling pathway
    110549680 (Mapk11)
   04071 Sphingolipid signaling pathway
    110549680 (Mapk11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110549680 (Mapk11)
   04218 Cellular senescence
    110549680 (Mapk11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110549680 (Mapk11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110549680 (Mapk11)
   04613 Neutrophil extracellular trap formation
    110549680 (Mapk11)
   04620 Toll-like receptor signaling pathway
    110549680 (Mapk11)
   04621 NOD-like receptor signaling pathway
    110549680 (Mapk11)
   04622 RIG-I-like receptor signaling pathway
    110549680 (Mapk11)
   04625 C-type lectin receptor signaling pathway
    110549680 (Mapk11)
   04660 T cell receptor signaling pathway
    110549680 (Mapk11)
   04658 Th1 and Th2 cell differentiation
    110549680 (Mapk11)
   04659 Th17 cell differentiation
    110549680 (Mapk11)
   04657 IL-17 signaling pathway
    110549680 (Mapk11)
   04664 Fc epsilon RI signaling pathway
    110549680 (Mapk11)
   04670 Leukocyte transendothelial migration
    110549680 (Mapk11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110549680 (Mapk11)
   04914 Progesterone-mediated oocyte maturation
    110549680 (Mapk11)
   04917 Prolactin signaling pathway
    110549680 (Mapk11)
   04926 Relaxin signaling pathway
    110549680 (Mapk11)
   04935 Growth hormone synthesis, secretion and action
    110549680 (Mapk11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110549680 (Mapk11)
  09156 Nervous system
   04728 Dopaminergic synapse
    110549680 (Mapk11)
   04723 Retrograde endocannabinoid signaling
    110549680 (Mapk11)
   04722 Neurotrophin signaling pathway
    110549680 (Mapk11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110549680 (Mapk11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110549680 (Mapk11)
  09159 Environmental adaptation
   04714 Thermogenesis
    110549680 (Mapk11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110549680 (Mapk11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110549680 (Mapk11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110549680 (Mapk11)
   05020 Prion disease
    110549680 (Mapk11)
   05022 Pathways of neurodegeneration - multiple diseases
    110549680 (Mapk11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110549680 (Mapk11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110549680 (Mapk11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110549680 (Mapk11)
   05135 Yersinia infection
    110549680 (Mapk11)
   05133 Pertussis
    110549680 (Mapk11)
   05152 Tuberculosis
    110549680 (Mapk11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110549680 (Mapk11)
   05161 Hepatitis B
    110549680 (Mapk11)
   05171 Coronavirus disease - COVID-19
    110549680 (Mapk11)
   05163 Human cytomegalovirus infection
    110549680 (Mapk11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110549680 (Mapk11)
   05169 Epstein-Barr virus infection
    110549680 (Mapk11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110549680 (Mapk11)
   05140 Leishmaniasis
    110549680 (Mapk11)
   05142 Chagas disease
    110549680 (Mapk11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110549680 (Mapk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110549680 (Mapk11)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110549680 (Mapk11)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110549680 (Mapk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 110549680
NCBI-ProteinID: XP_021494652
LinkDB
Position
Unknown
AA seq 386 aa
MLSPLKGVFYGTSRRGGMETSWGEQAGTGLLGASRGASLPHWCRVNSGQAPARPLIRPPC
SSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIED
FSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAV
NEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQ
GKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGAN
PLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWK
ELTYQEVLSFKPLEPSQLPGNHEIEQ
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgctgagtccactcaagggggtcttctatgggacgtccaggaggggtggcatggagacg
tcgtggggtgaacaggcagggacaggcctccttggagccagccgcggagcctcgctcccg
cactggtgtagggtgaactcaggccaggcgcccgcgcgtcctctcattcgcccaccttgc
agctcggcctacgacgcgcggttgcgccagaaggtggctgtgaagaagctgtctcgccct
ttccaatcgctgatccatgcgaggaggacgtaccgtgagctgcgcctactcaaacacctg
aagcatgagaacgtcatagggcttctggacgtcttcacgcccgccacctccattgaggat
ttcagcgaagtgtacctggtgaccaccctgatgggcgccgacctgaataacatcgtcaag
tgtcaggcactgagcgatgagcatgttcagttcctggtctaccagctgctgcgtgggctg
aagtatatccactcggcaggcatcatccaccgggacctgaagcccagcaatgtagcagtg
aatgaggactgcgagctgaggatcctggacttcgggctggcgcgccaggctgatgaggag
atgactggatacgtggccacacggtggtaccgggcaccagagatcatgctgaactggatg
cactacaaccagacagtggacatctggtctgtgggctgcatcatggctgagctgttgcaa
ggaaaggccctcttccctgggaacgactacatcgaccagctgaagcgaatcatggaggtg
gtgggcacacccagccctgaggttctggcaaagatatcctcggagcacgcccggacatat
atccagtctctgccccccatgccccagaaggacctcagcagtgtcttccatggagccaac
cctctggccatagacctccttggaagaatgctggtgctagacagtgaccaaagggtcagt
gcagcggaagccttggcccatgcatactttagccagtatcatgaccctgatgacgagcca
gaggccgagccttatgatgaaagtgtcgaggccaaggagcgcacactggaggagtggaag
gagcttacttaccaagaagtccttagcttcaagcccctggagccatcccagctacccggc
aaccatgagattgagcagtga

DBGET integrated database retrieval system