KEGG   Meriones unguiculatus (Mongolian gerbil): 110546586
Entry
110546586         CDS       T05884                                 

Gene name
Cdkn1a
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04012  ErbB signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04110  Cell cycle
mun04115  p53 signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04218  Cellular senescence
mun04630  JAK-STAT signaling pathway
mun04921  Oxytocin signaling pathway
mun04928  Parathyroid hormone synthesis, secretion and action
mun04934  Cushing syndrome
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05216  Thyroid cancer
mun05217  Basal cell carcinoma
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110546586 (Cdkn1a)
   04630 JAK-STAT signaling pathway
    110546586 (Cdkn1a)
   04066 HIF-1 signaling pathway
    110546586 (Cdkn1a)
   04068 FoxO signaling pathway
    110546586 (Cdkn1a)
   04151 PI3K-Akt signaling pathway
    110546586 (Cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110546586 (Cdkn1a)
   04115 p53 signaling pathway
    110546586 (Cdkn1a)
   04218 Cellular senescence
    110546586 (Cdkn1a)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    110546586 (Cdkn1a)
   04928 Parathyroid hormone synthesis, secretion and action
    110546586 (Cdkn1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110546586 (Cdkn1a)
   05202 Transcriptional misregulation in cancer
    110546586 (Cdkn1a)
   05206 MicroRNAs in cancer
    110546586 (Cdkn1a)
   05205 Proteoglycans in cancer
    110546586 (Cdkn1a)
   05203 Viral carcinogenesis
    110546586 (Cdkn1a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110546586 (Cdkn1a)
   05212 Pancreatic cancer
    110546586 (Cdkn1a)
   05225 Hepatocellular carcinoma
    110546586 (Cdkn1a)
   05226 Gastric cancer
    110546586 (Cdkn1a)
   05214 Glioma
    110546586 (Cdkn1a)
   05216 Thyroid cancer
    110546586 (Cdkn1a)
   05220 Chronic myeloid leukemia
    110546586 (Cdkn1a)
   05217 Basal cell carcinoma
    110546586 (Cdkn1a)
   05218 Melanoma
    110546586 (Cdkn1a)
   05211 Renal cell carcinoma
    110546586 (Cdkn1a)
   05219 Bladder cancer
    110546586 (Cdkn1a)
   05215 Prostate cancer
    110546586 (Cdkn1a)
   05213 Endometrial cancer
    110546586 (Cdkn1a)
   05224 Breast cancer
    110546586 (Cdkn1a)
   05222 Small cell lung cancer
    110546586 (Cdkn1a)
   05223 Non-small cell lung cancer
    110546586 (Cdkn1a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110546586 (Cdkn1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110546586 (Cdkn1a)
   05161 Hepatitis B
    110546586 (Cdkn1a)
   05160 Hepatitis C
    110546586 (Cdkn1a)
   05163 Human cytomegalovirus infection
    110546586 (Cdkn1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110546586 (Cdkn1a)
   05169 Epstein-Barr virus infection
    110546586 (Cdkn1a)
   05165 Human papillomavirus infection
    110546586 (Cdkn1a)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110546586 (Cdkn1a)
   01522 Endocrine resistance
    110546586 (Cdkn1a)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110546586
NCBI-ProteinID: XP_021489160
LinkDB
Position
Unknown
AA seq 163 aa
MSEAEDPRATPHRSKACRRLFGPVDSEQLRRDYDALMAGCLREARERWNFDFATETPLEG
DFVWERVRGPALPKLYLSPGSRRGRDDLGGDRRPGPSSALLQGPAPQDHADLSLSCTLVP
HAPERPEDSPGGLGAPQGRKRRQTSLTDFYHSKRRLVFCKRKP
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtctgaggccgaggacccccgagcgaccccgcaccggagcaaggcgtgccgccgcctc
ttcgggccggtggacagcgagcagctgcggcgcgactacgacgcgctcatggccggctgc
ctgcgcgaggcccgggagcgctggaacttcgacttcgccaccgagacgccgctggagggc
gacttcgtgtgggagcgggttcgaggcccggcgctgcccaagctctacctgagccccggc
tcccgccgcggccgcgacgacctgggaggggacaggaggcccgggccctcctccgccctg
ctgcagggcccggccccgcaggaccacgcggacctgtcgctgtcctgcaccctggtgccc
cacgccccggagcggcccgaagactccccgggtggcctcggggcgccccagggccgcaag
cggaggcagaccagcctgacagatttctatcactccaagcgtcggctggtcttctgcaag
aggaagccctga

DBGET integrated database retrieval system