KEGG   Meriones unguiculatus (Mongolian gerbil): 110546689
Entry
110546689         CDS       T05884                                 

Gene name
Csnk1a1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04310  Wnt signaling pathway
mun04340  Hedgehog signaling pathway
mun05010  Alzheimer disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05165  Human papillomavirus infection
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110546689 (Csnk1a1)
   04340 Hedgehog signaling pathway
    110546689 (Csnk1a1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110546689 (Csnk1a1)
   05226 Gastric cancer
    110546689 (Csnk1a1)
   05224 Breast cancer
    110546689 (Csnk1a1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110546689 (Csnk1a1)
   05022 Pathways of neurodegeneration - multiple diseases
    110546689 (Csnk1a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110546689 (Csnk1a1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110546689 (Csnk1a1)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110546689 (Csnk1a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 110546689
NCBI-ProteinID: XP_021489356
LinkDB
Position
Unknown
AA seq 405 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGTQLIIQQLNQNTEGKTLKYLERLIYYEYIQSKEDQGTQSSC
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgaatttatcgtcggagggaaatacaaactggta
cggaagatcggatctggctccttcggggacatttatctggcgatcaacatcaccaatggc
gaggaagtggcagtgaagctagagtcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagatccttcaaggtggggttggcatccctcacatacggtggtatgga
caagaaaaagactacaatgtgctagtcatggatctcctggggcccagccttgaagacctc
ttcaatttctgttcaagaaggttcactatgaagactgtacttatgttagctgaccagatg
atcagtagaattgagtatgtgcacacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtccttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaacctcactggcactgcccgatatgctagcatcaatgca
catcttggtattgagcagagtcgccgagatgacatggaatctttaggatatgttttgatg
tattttaatagaaccagtctcccatggcaagggctaaaagctgctacaaagaaacaaaaa
tatgaaaagattagtgaaaagaagatgtccactcctgttgaggttttgtgtaaggggttt
cctgcagaatttgccatgtacttaaattactgtcgtgggctgcgctttgaggaagctccg
gattacatgtatctgaggcagctattccgcatccttttcaggaccctgaaccaccagtat
gactatacatttgattggacaatgttaaagcagaaagcagcacagcaggcagcctcttcc
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggaacacagctgataattcagcaacttaaccaaaacacagaagggaagacc
ttgaagtatctggaaagactgatctactatgaatacattcagtctaaagaagaccaggga
actcaatcttcttgctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110548832
Entry
110548832         CDS       T05884                                 

Gene name
Csnk1d
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun04390  Hippo signaling pathway
mun04540  Gap junction
mun04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110548832 (Csnk1d)
   04390 Hippo signaling pathway
    110548832 (Csnk1d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110548832 (Csnk1d)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110548832 (Csnk1d)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110548832 (Csnk1d)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110548832 (Csnk1d)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110548832 (Csnk1d)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 110548832
NCBI-ProteinID: XP_021493109
LinkDB
Position
Unknown
AA seq 415 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagctgagggtcgggaacaggtaccggctgggccgcaagatcggcagcggctccttt
ggagacatctatctcggcacggacattgctgcaggtgaagaagttgccatcaagctagaa
tgtgttaaaaccaaacatcctcagctccacattgagagcaagatctacaaaatgatgcag
ggaggagtgggcatcccaaccatcagatggtgtggggctgagggggactacaatgtcatg
gtgatggagctactgggacccagcttggaagacctcttcaacttctgttcaaggaagttt
agtctcaaaactgttctgttgcttgctgaccaaatgataagtcgtattgagtacattcat
tcaaagaattttatccaccgagatgtgaagccagacaacttcctcatggggctgggaaag
aaaggcaacctggtttacatcattgacttcgggctggccaagaagtatcgggatgcccgc
acccaccagcacatcccctaccgagagaacaagaacctcacagggacggcacgctatgcc
tcgatcaacacgcaccttggcattgaacaatctcgaagggatgacttggagtctctgggg
tacgtgctgatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagaggcagaagtatgagaggatcagtgagaagaagatgtccactcccattgaagtgctg
tgcaagggctatccttctgaatttgccacatacctgaatttctgccgttccttgcgtttt
gatgacaaacctgactactcctacctgaggcagctcttcagaaacctgttccatcgccag
ggcttctcctacgactatgtgttcgactggaacatgctcaaatttggtgccagccgagct
gcagatgatgctgagcgggaacgccgggaccgagaggaacgattaagacactcccggaat
ccagccacgcgtggcctcccttctacagcttccggccgcctgcggggaacccaggaagtg
gctcctccaacgccccttacccctacctcacacacggccaacacctctcctcggcccgtc
tctggcatggaacgagaaaggaaagtgagtatgcggctgcaccgtggggcgcctgtcaac
gtctcctcatctgacctcacgggccgacaagatacctctcgcatgtccacctcacagatt
cccggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110552702
Entry
110552702         CDS       T05884                                 

Gene name
Csnk1g1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110552702 (Csnk1g1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110552702 (Csnk1g1)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110552702 (Csnk1g1)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 110552702
NCBI-ProteinID: XP_021499898
LinkDB
Position
Unknown
AA seq 459 aa
MDHSNREKDDRQRTTKAMAQRNTHCSRPSGTTTSSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLEL
LGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFE
KPDYEYLRTLFSDLFERKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRERP
SQQQPLRNQTTSSERRGEWEIQPSRQTNTSYLTSHLAADRHGGSVQVVSSTNGELNVDDP
TGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQRHK
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggaccattctaacagggaaaaggatgacagacagcggacaactaaagccatggcacaa
aggaatacacactgttcccgaccatctggcaccacaacatcctctggggttctcatggtg
ggacccaacttcagagttggcaagaagatagggtgtgggaacttcggagaactcagatta
ggaaaaaatctctacaccaatgaatatgtagccatcaaactggaaccaataaaatcacgt
gctccacagcttcatttagagtacaggttttataaacagcttggaagtgcaggtgaaggc
ctcccacaggtgtattactttgggccatgtgggaagtacaatgccatggttctggagctc
cttggccctagcttggaggacttgtttgacctctgtgaccgaacgtttactttgaaaacg
gtattaatgatagccatccagttgctttctcgaatggagtatgtacactcaaagaatctc
atttaccgagatgtcaaaccagagaacttcttgattggccgacaaggcaataagaaagaa
catgtaatacacattatagattttggtctggccaaggaatacattgatcctgaaaccaaa
aaacacataccttacagagagcacaaaagcttaactggaactgcacgatacatgtctatc
aacacgcatcttggcaaagagcaaagccggcgagatgatttggaagccttaggccatatg
ttcatgtacttccttcgcggcagcctaccctggcaaggactcaaggctgatacattaaaa
gagagatatcaaaaaattggtgataccaaaaggaatactcccattgaagctctgtgtgag
aactttccagaggagatggcaacctaccttcgatatgtcaggcgattagacttctttgaa
aaacctgattatgagtatttacggactctcttttcggatctgtttgaacggaaaggctac
acctttgactatgcctatgactgggttggaaggcctattcctactccggtaggatcagtt
catgtcgattctggtgcatctgcaataactcgagaaagccacacacacagggaaaggcca
tcacagcaacagcctcttcgaaatcagactacatcatcagagcgccgaggagagtgggaa
atccagcccagccggcagaccaatacctcatacctgacgtctcacttggccgcagaccgc
catgggggttcagtacaggtggttagctcaaccaatggagagctgaatgttgatgacccc
actggagctcactcgaatgcaccaatcacagctcatgccgaggtggaggtagtggaggaa
gctaagtgctgctgtttctttaagagaaaaaggaagaagactgctcagcgacacaagtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110555594
Entry
110555594         CDS       T05884                                 

Gene name
Csnk1g2
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110555594 (Csnk1g2)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110555594 (Csnk1g2)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110555594 (Csnk1g2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CK1gamma_C Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 110555594
NCBI-ProteinID: XP_021504544
LinkDB
Position
Unknown
AA seq 415 aa
MDFDKKGGKGELEEGRRMSKTGANRSNHGVRSTGTSSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLSTAEGVPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFTLKTVLMIAIQLISRMEYVHTKSLIYRDVKPENFLVGRPGSKR
QHSIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRSGYVFDYEYDWAGKPLPTPIGTVHADLPTQPPHRDKAPPHNK
NQALNSTNGELNTDDPTAGHSNAPIAAPAEVEVADETKCCCFFKRRKRKSLQRHK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggattttgacaagaaaggagggaagggggagttggaggagggccggagaatgtccaag
accggcgcgaaccggagcaaccacggcgtccgcagtacggggaccagctcaggggtcttg
atggtgggccccaactttcgagtcggcaagaagataggctgtgggaacttcggagagctt
cgcctaggaaagaacctgtatacaaatgagtacgtggctatcaagctggagcccatcaag
tcccgggccccgcagctgcacttggagtaccgcttctacaagcagctcagcacagcagaa
ggtgtccctcaggtctactacttcggcccgtgcgggaagtataacgccatggtgctggag
ctgctggggcccagcctggaggacctgttcgacctgtgtgaccgcaccttcacgctgaag
acggtgctcatgatcgccatccagctgatctcgcgcatggagtacgtgcacaccaagagc
ctcatctaccgcgatgtgaagcccgagaacttcctggtcgggcggccgggcagcaagcgg
cagcactccatccacatcatcgacttcgggctggccaaggagtacatcgaccccgagacc
aagaagcacatcccctaccgcgagcacaagagcctgacgggcacggcgcgctacatgagc
atcaacacgcacctgggcaaggagcagagccgccgggacgacctggaggcgctgggccac
atgttcatgtacttcctgcgaggcagtctgccctggcaggggctcaaggccgacacgctg
aaggaacgctaccagaagatcggggacaccaagcgcgccacgcccatcgaggtgctgtgc
gagagcttcccggaggagatggccacgtacttgcgctacgtgcggcgcctggacttcttc
gagaagccggactacgactacctgaggaagctgttcaccgacctcttcgaccgcagcggc
tatgtgtttgactacgagtacgactgggccgggaagcccctgccaacgcccatcggcacg
gtccacgctgacctgcccacccagccaccacatcgcgacaaagccccgccccacaacaag
aaccaggcgctgaactccaccaacggagagctgaacacggacgaccccaccgcgggccac
tccaacgcccccatcgcggcccccgcagaggtggaggtggcggatgaaaccaagtgctgc
tgcttcttcaagaggagaaagagaaaatcgcttcagcgacacaagtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110559893
Entry
110559893         CDS       T05884                                 

Gene name
Csnk1g3
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110559893 (Csnk1g3)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110559893 (Csnk1g3)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110559893 (Csnk1g3)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 110559893
NCBI-ProteinID: XP_021511204
LinkDB
Position
Unknown
AA seq 456 aa
MDNKKKDKDKSDDRMARPSGRSGHSTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLG
KNLYTNEYVAIKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKAQQV
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPEEMATYLRYVRRLDFFEKP
DYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQHRDKMQQS
KNQSADHRAAWDSQQANPHHLRAHLAADRHGGSVQVVSSTNGELNTDDPTAGRSNAPITA
PTEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQRHK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggataataaaaagaaagacaaggacaaatcagatgatagaatggcacggcccagtggt
cgatcagggcacagcactcgaggaactgggtcttcttcatctggagttttaatggttgga
cctaactttagagttgggaaaaaaattggatgtggcaattttggagaattacgattaggg
aaaaatttatacacaaatgaatatgtggcgattaaactggagcccatgaaatccagagca
ccacagttgcatttggaatacagattctataagcagttaggatctggagatggtatacct
caagtttactattttggcccttgtggtaaatacaatgctatggtgctggaactgctggga
cctagtttggaagatttgtttgacctctgtgatagaacgttttctcttaaaacagttctc
atgatagctatacaactgatttctcgcatggagtatgtccactcaaagaacttgatatac
agagatgtgaagccagagaacttcttaataggccggccgggaaacaaagcccagcaagtc
attcatattatagattttggtttggcaaaggaatatattgatccagagacaaagaaacat
ataccatacagagaacacaaaagccttaccggaacagccagatacatgagcataaacaca
catctaggaaaagaacagagtagaagagatgatttagaagctttaggccatatgttcatg
tactttctaagaggcagtcttccttggcaaggcttaaaggctgacacattaaaggagagg
tatcagaaaattggagacacgaaacgagccacaccaatagaagtgttgtgtgaaaacttt
ccagaagaaatggcaacatatcttcgttatgtacgaaggctagatttttttgaaaagcca
gactatgattacctaagaaagctttttactgacttgtttgatcgcaaaggatatatgttt
gattatgaatatgactggattggtaaacagttgcctactccagtgggtgcagttcagcaa
gatcctgctctgtcgtctaacagagaagcacaccaacacagagataagatgcagcagtct
aaaaaccagtcggcagaccacagggcagcttgggactcccagcaggcaaatccccatcat
ttgagagctcaccttgcagcagacagacatggtggctcggtacaggttgtaagttctaca
aatggagagctgaacacggatgaccccacggcaggacggtcaaatgcacccatcacagcc
cctacagaagtagaagtgatggatgaaaccaactgccagaaagtattgaatatgtggtgc
tgctgttttttcaaacgaaggaaaaggaaaaccatacaacgtcacaaatga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110564247
Entry
110564247         CDS       T05884                                 

Definition
(RefSeq) casein kinase I isoform X1
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04068  FoxO signaling pathway
mun04310  Wnt signaling pathway
mun04340  Hedgehog signaling pathway
mun04390  Hippo signaling pathway
mun04392  Hippo signaling pathway - multiple species
mun04710  Circadian rhythm
mun05010  Alzheimer disease
mun05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110564247
   04340 Hedgehog signaling pathway
    110564247
   04390 Hippo signaling pathway
    110564247
   04392 Hippo signaling pathway - multiple species
    110564247
   04068 FoxO signaling pathway
    110564247
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110564247
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110564247
   05022 Pathways of neurodegeneration - multiple diseases
    110564247
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110564247
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   110564247
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110564247
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 110564247
NCBI-ProteinID: XP_021517286
LinkDB
Position
Unknown
AA seq 431 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFMRPPF
CQPPALPCGRPQDQLGCSPESRGRRPGATRTRTGREDGAVAGVRDQSPAPWPARGGHRQP
TPKRSRACGFHPGLPHPTSWQYFSQSDLTGRPGEEGEHETPQRCACQRLLFRPHWAARGL
PDCSLTDKRAI
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggagctgcgtgtgggaaataaataccgcttgggccgaaagatcggcagtgggtccttt
ggagacatctacttgggtgccaacattgcctctggtgaggaagtagccatcaagctggaa
tgtgtgaagacgaagcatcctcagctccacatcgagagcaagttctacaagatgatgcaa
ggaggagtggggatcccgtccatcaaatggtgcggggctgagggtgactacaatgtgatg
gtcatggagctgctggggcccagtttggaggacctcttcaacttctgttcccgaaagttc
agcctcaagacggtgctgttgctggccgaccagatgatcagccgcattgagtatatccac
tccaagaacttcatccaccgggacgtgaagcctgacaacttcctcatgggcctggggaag
aaaggcaacctggtctatatcattgacttcggcctggccaagaaataccgcgacgcccgc
acccaccagcatatcccctaccgggaaaacaagaacctgactggcactgcccgctatgcc
tccatcaacacccacctgggtatcgagcaaagccgtcgagatgacctggagagcctgggc
tatgtgctcatgtacttcaacctgggctccctgccctggcagggcctcaaagcggccacc
aagcggcagaagtacgagcggatcagcgagaagaagatgtcaacgcccatcgaggtcctc
tgcaaaggctacccctccgagttttcaacatacctcaacttctgccgctccctgcggttc
gatgacaagcccgactactcctacctgcgccagctcttccgcaacctctttcaccggcag
ggtttctcctacgactacgtttttgactggaacatgctcaaattcatgcggccccccttc
tgccagccccctgcccttccctgtggacggccccaggaccagctagggtgcagcccggaa
tcccgaggacgtagaccgggagcgacgagaacacgaacgggaagagaggatggggcagtt
gcgggggtccgcgaccagagccctgccccctggcccgcccgcgggggccaccgccaaccg
actccgaagcgcagccgagcctgtggcttccaccccggcctcccgcatccaacaagctgg
caatacttctcccagagcgatctcacgggccgaccgggagaggaaggtgagcatgagact
ccacagaggtgcgcctgccaacgtctcctcttcagacctcactgggcggcaagaggtctc
ccggattgcagcctcacagacaagcgtgccatttga

DBGET integrated database retrieval system