KEGG   Meriones unguiculatus (Mongolian gerbil): 110546819
Entry
110546819         CDS       T05884                                 

Definition
(RefSeq) interferon regulatory factor 3-like isoform X1
  KO
K05411  interferon regulatory factor 3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun05133  Pertussis
mun05135  Yersinia infection
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110546819
   04621 NOD-like receptor signaling pathway
    110546819
   04622 RIG-I-like receptor signaling pathway
    110546819
   04623 Cytosolic DNA-sensing pathway
    110546819
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110546819
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110546819
   05133 Pertussis
    110546819
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110546819
   05161 Hepatitis B
    110546819
   05160 Hepatitis C
    110546819
   05171 Coronavirus disease - COVID-19
    110546819
   05164 Influenza A
    110546819
   05162 Measles
    110546819
   05168 Herpes simplex virus 1 infection
    110546819
   05163 Human cytomegalovirus infection
    110546819
   05167 Kaposi sarcoma-associated herpesvirus infection
    110546819
   05169 Epstein-Barr virus infection
    110546819
   05165 Human papillomavirus infection
    110546819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110546819
   04131 Membrane trafficking [BR:mun04131]
    110546819
Transcription factors [BR:mun03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    110546819
Membrane trafficking [BR:mun04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    110546819
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 110546819
NCBI-ProteinID: XP_021489614
LinkDB
Position
Unknown
AA seq 431 aa
MQTQDVCEGRSMGTSKPRILPWLVSQLDLGQLKGVAWLDESRTRFRIPWKHGLRQDAQMA
DFGIFQAWAEASGAYTPGKDKPDLSTWKRNFRSALNRKEVLRLADDRSKDPFDPHKVYEF
VTPGARDFVHLDTSPDTNGKSSPSDRQEDLLELLDDMVLGSLPDEGSSGLAIAPDHSQLL
PSPSLDSFPKPAPQENPLRQLLAEEQWEFEVTAFYRGRQAFQQTLFCPGGLRLVGTATDS
GTLPWQPVTLPDPEGLLTDKLAREYVRHVLKGLGEGLALWRAGQCLWAQRLGHAHSFWAL
GEELLPDVGRGPQGEVPKDKDGGVFDLRPFVADLIAFMEGSGQSPRYTLWFCVGESWPQD
QPWVKRLVMVKVVPTCLRELLEMAREGGASSLKTVDLHISNSQPISLTSDQYKAYLQDLV
EDMDFQASGDT
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgcagactcaggacgtgtgcgaaggtcggagcatgggaacctcgaaaccacggatcttg
ccctggctggtgtcccagctggacctggggcagctgaaaggcgtggcctggctggacgag
agccgtacgaggttccggatcccgtggaagcatggcctgcgacaggatgcacagatggct
gattttggcatcttccaggcctgggccgaagccagtggcgcctacaccccaggaaaggat
aagccagacctgtccacctggaagaggaatttccggtcagccctgaaccgaaaagaagtg
ttgcgactagccgatgaccgaagcaaggacccttttgaccctcataaagtgtatgagttt
gtgactccaggggcgagggactttgtacatctggacacctcccctgacaccaatggcaaa
agcagtccgtctgaccgccaggaagacctcctggaattactagatgacatggtcttggga
tccctcccagatgaggggtcctcaggtctggctattgctcctgatcactctcagctactg
ccaagtcccagtttggatagcttcccaaaaccagcaccccaggaaaatccactgaggcag
ctgctagctgaggaacagtgggagttcgaggtgaccgctttctaccggggccgccaggcc
ttccagcagacactcttttgcccagggggcctgcggctggtgggcaccgcaactgacagc
ggaacactgccctggcagccagtcaccctgccagaccctgaggggcttctgacagacaag
ctcgcgagggagtacgtgaggcatgtactcaaggggctgggcgaggggctggcactgtgg
cgggcagggcagtgtctctgggcccagcgcctgggccacgcccattccttctgggctctg
ggtgaggagctgcttccagacgtcgggagagggccacagggagaggtccccaaggacaag
gatggaggcgtgttcgacctcaggccctttgtggcagatctgatcgccttcatggaagga
agcggacagtccccacgctacactctgtggttttgtgtgggggagtcgtggccacaggac
cagccgtgggtcaagaggcttgtgatggtcaaggttgttcctacatgtctcagggagctg
ttagagatggcccgggaaggaggagcctcctcgctgaaaactgtggacttgcacatctcc
aacagccagcctatctccctcacctccgaccagtacaaggcctacctccaggacttggtg
gaggacatggacttccaagccagtggagatacctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110546826
Entry
110546826         CDS       T05884                                 

Definition
(RefSeq) interferon regulatory factor 3-like isoform X1
  KO
K05411  interferon regulatory factor 3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun05133  Pertussis
mun05135  Yersinia infection
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110546826
   04621 NOD-like receptor signaling pathway
    110546826
   04622 RIG-I-like receptor signaling pathway
    110546826
   04623 Cytosolic DNA-sensing pathway
    110546826
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110546826
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110546826
   05133 Pertussis
    110546826
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110546826
   05161 Hepatitis B
    110546826
   05160 Hepatitis C
    110546826
   05171 Coronavirus disease - COVID-19
    110546826
   05164 Influenza A
    110546826
   05162 Measles
    110546826
   05168 Herpes simplex virus 1 infection
    110546826
   05163 Human cytomegalovirus infection
    110546826
   05167 Kaposi sarcoma-associated herpesvirus infection
    110546826
   05169 Epstein-Barr virus infection
    110546826
   05165 Human papillomavirus infection
    110546826
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110546826
   04131 Membrane trafficking [BR:mun04131]
    110546826
Transcription factors [BR:mun03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    110546826
Membrane trafficking [BR:mun04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    110546826
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 110546826
NCBI-ProteinID: XP_021489624
LinkDB
Position
Unknown
AA seq 431 aa
MQTQDVCEGRSMGTSKPRILPWLVSQLDLGQLKGVAWLDESRTRFRIPWKHGLRQDAQMA
DFGIFQAWAEASGAYTPGKDKPDLSTWKRNFRSALNRKEVLRLADDRSKDPFDPHKVYEF
VTPGARDFVHLDTSPDTNGKSSPSDRQEDLLELLDDMVLGSLPDEGSSGLAIAPDHSQLL
PSPSLDSFPKPAPQENPLRQLLAEEQWEFEVTAFYRGRQAFQQTLFCPGGLRLVGTATDS
GTLPWQPVTLPDPEGLLTDKLAREYVRHVLKGLGEGLALWRAGQCLWAQRLGHAHSFWAL
GEELLPDVGRGPQGEVPKDKDGGVFDLRPFVADLIAFMEGSGQSPRYTLWFCVGESWPQD
QPWVKRLVMVKVVPTCLRELLEMAREGGASSLKTVDLHISNSQPISLTSDQYKAYLQDLV
EDMDFQASGDT
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgcagactcaggacgtgtgcgaaggtcggagcatgggaacctcgaaaccacggatcttg
ccctggctggtgtcccagctggacctggggcagctgaaaggcgtggcctggctggacgag
agccgtacgaggttccggatcccgtggaagcatggcctgcgacaggatgcacagatggct
gattttggcatcttccaggcctgggccgaagccagtggcgcctacaccccaggaaaggat
aagccagacctgtccacctggaagaggaatttccggtcagccctgaaccgaaaagaagtg
ttgcgactagccgatgaccgaagcaaggacccttttgaccctcataaagtgtatgagttt
gtgactccaggggcgagggactttgtacatctggacacctcccctgacaccaatggcaaa
agcagtccgtctgaccgccaggaagacctcctggaattactagatgacatggtcttggga
tccctcccagatgaggggtcctcaggtctggctattgctcctgatcactctcagctactg
ccaagtcccagtttggatagcttcccaaaaccagcaccccaggaaaatccactgaggcag
ctgctagctgaggaacagtgggagttcgaggtgaccgctttctaccggggccgccaggcc
ttccagcagacactcttttgcccagggggcctgcggctggtgggcaccgcaactgacagc
ggaacactgccctggcagccagtcaccctgccagaccctgaggggcttctgacagacaag
ctcgcgagggagtacgtgaggcatgtactcaaggggctgggcgaggggctggcactgtgg
cgggcagggcagtgtctctgggcccagcgcctgggccacgcccattccttctgggctctg
ggtgaggagctgcttccagacgtcgggagagggccacagggagaggtccccaaggacaag
gatggaggcgtgttcgacctcaggccctttgtggcagatctgatcgccttcatggaagga
agcggacagtccccacgctacactctgtggttttgtgtgggggagtcgtggccacaggac
cagccgtgggtcaagaggcttgtgatggtcaaggttgttcctacatgtctcagggagctg
ttagagatggcccgggaaggaggagcctcctcgctgaaaactgtggacttgcacatctcc
aacagccagcctatctccctcacctccgaccagtacaaggcctacctccaggacttggtg
gaggacatggacttccaagccagtggagatacctga

DBGET integrated database retrieval system