KEGG   Meriones unguiculatus (Mongolian gerbil): 110546885
Entry
110546885         CDS       T05884                                 

Gene name
Fadd
Definition
(RefSeq) FAS-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01524  Platinum drug resistance
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04668  TNF signaling pathway
mun05010  Alzheimer disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05142  Chagas disease
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110546885 (Fadd)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110546885 (Fadd)
   04215 Apoptosis - multiple species
    110546885 (Fadd)
   04217 Necroptosis
    110546885 (Fadd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110546885 (Fadd)
   04621 NOD-like receptor signaling pathway
    110546885 (Fadd)
   04622 RIG-I-like receptor signaling pathway
    110546885 (Fadd)
   04657 IL-17 signaling pathway
    110546885 (Fadd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110546885 (Fadd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110546885 (Fadd)
   05022 Pathways of neurodegeneration - multiple diseases
    110546885 (Fadd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110546885 (Fadd)
   05152 Tuberculosis
    110546885 (Fadd)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110546885 (Fadd)
   05161 Hepatitis B
    110546885 (Fadd)
   05160 Hepatitis C
    110546885 (Fadd)
   05164 Influenza A
    110546885 (Fadd)
   05162 Measles
    110546885 (Fadd)
   05168 Herpes simplex virus 1 infection
    110546885 (Fadd)
   05163 Human cytomegalovirus infection
    110546885 (Fadd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110546885 (Fadd)
   05169 Epstein-Barr virus infection
    110546885 (Fadd)
   05165 Human papillomavirus infection
    110546885 (Fadd)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110546885 (Fadd)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110546885 (Fadd)
SSDB
Motif
Pfam: DED Death
Other DBs
NCBI-GeneID: 110546885
NCBI-ProteinID: XP_021489754
LinkDB
Position
Unknown
AA seq 208 aa
MDPFLVLLHSLSGSLSNSDLMELKFLCRGRVGKRKLERVQSGLDLFSVLLEQNDLERTRT
GLLRELLVSLRRHDLLQRLDDFEAGVAASAAPGEADLRVAFDIVCDNVGRDWKRLARFLN
LSEVKIDGIEERYPRSLNEQVRETLRVWRNTEREKATVAGLVRALRACQLNLVADLVEEA
PQVRGSVSGSEDVSSMLWDSMVFSSEAP
NT seq 627 nt   +upstreamnt  +downstreamnt
atggacccgttcctggtgctgctgcattcgctgtccggcagcctgtcgaacagcgatctg
atggaactaaagttcctttgccgcgggcgcgtgggcaaacgaaagctggagcgcgtgcag
agtggcctggacctgttctcggtgctgctggagcagaacgacctggagcgcacgcgcact
gggctgctgcgcgagttgctggtctcgttgcggagacacgacctactgcaacgcctggac
gacttcgaggcgggggtggcggcctctgccgcgccgggggaggcagatctgcgggtggca
tttgacatcgtgtgtgacaatgtggggagagactggaagagactggcccgctttctaaac
ttgtctgaggtcaagattgatgggattgaggagagatacccccgaagcctgaacgagcaa
gtaagggagactctgagggtctggaggaataccgagagggagaaagccacggtggctggg
ctggtaagggcgctgcgggcctgccagctgaacctggtggctgacctggtagaagaagca
ccgcaggtccggggatctgtgagtgggagcgaggatgtgtcctcgatgctatgggactca
atggtgttttcctcagaagcaccctga

DBGET integrated database retrieval system