KEGG   Meriones unguiculatus (Mongolian gerbil): 110546940
Entry
110546940         CDS       T05884                                 

Gene name
Ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04068  FoxO signaling pathway
mun04110  Cell cycle
mun04115  p53 signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04218  Cellular senescence
mun04310  Wnt signaling pathway
mun04340  Hedgehog signaling pathway
mun04371  Apelin signaling pathway
mun04390  Hippo signaling pathway
mun04510  Focal adhesion
mun04530  Tight junction
mun04630  JAK-STAT signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04921  Oxytocin signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04934  Cushing syndrome
mun05160  Hepatitis C
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05216  Thyroid cancer
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110546940 (Ccnd1)
   04340 Hedgehog signaling pathway
    110546940 (Ccnd1)
   04390 Hippo signaling pathway
    110546940 (Ccnd1)
   04371 Apelin signaling pathway
    110546940 (Ccnd1)
   04630 JAK-STAT signaling pathway
    110546940 (Ccnd1)
   04068 FoxO signaling pathway
    110546940 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    110546940 (Ccnd1)
   04152 AMPK signaling pathway
    110546940 (Ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110546940 (Ccnd1)
   04115 p53 signaling pathway
    110546940 (Ccnd1)
   04218 Cellular senescence
    110546940 (Ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110546940 (Ccnd1)
   04530 Tight junction
    110546940 (Ccnd1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110546940 (Ccnd1)
   04921 Oxytocin signaling pathway
    110546940 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    110546940 (Ccnd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110546940 (Ccnd1)
   05206 MicroRNAs in cancer
    110546940 (Ccnd1)
   05205 Proteoglycans in cancer
    110546940 (Ccnd1)
   05203 Viral carcinogenesis
    110546940 (Ccnd1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110546940 (Ccnd1)
   05212 Pancreatic cancer
    110546940 (Ccnd1)
   05225 Hepatocellular carcinoma
    110546940 (Ccnd1)
   05226 Gastric cancer
    110546940 (Ccnd1)
   05214 Glioma
    110546940 (Ccnd1)
   05216 Thyroid cancer
    110546940 (Ccnd1)
   05221 Acute myeloid leukemia
    110546940 (Ccnd1)
   05220 Chronic myeloid leukemia
    110546940 (Ccnd1)
   05218 Melanoma
    110546940 (Ccnd1)
   05219 Bladder cancer
    110546940 (Ccnd1)
   05215 Prostate cancer
    110546940 (Ccnd1)
   05213 Endometrial cancer
    110546940 (Ccnd1)
   05224 Breast cancer
    110546940 (Ccnd1)
   05222 Small cell lung cancer
    110546940 (Ccnd1)
   05223 Non-small cell lung cancer
    110546940 (Ccnd1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110546940 (Ccnd1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110546940 (Ccnd1)
   04934 Cushing syndrome
    110546940 (Ccnd1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110546940 (Ccnd1)
   05162 Measles
    110546940 (Ccnd1)
   05160 Hepatitis C
    110546940 (Ccnd1)
   05163 Human cytomegalovirus infection
    110546940 (Ccnd1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110546940 (Ccnd1)
   05169 Epstein-Barr virus infection
    110546940 (Ccnd1)
   05165 Human papillomavirus infection
    110546940 (Ccnd1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110546940 (Ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110546940
NCBI-ProteinID: XP_021489819
LinkDB
Position
Unknown
AA seq 295 aa
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQREIVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGAACMFVASKMKETIPLT
AEKLCIYTDNSIQPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEAEEEAGLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggagaccatccgccgcgcgtacccggacacc
aacctcctcaacgaccgagtgctgcgagccatgctcaagaccgaggagacctgcgcgccc
tccgtgtcttacttcaagtgcgtgcagagggagatcgtgccgtccatgaggaaaatcgtg
gccacctggatgctggaggtctgtgaggagcagaagtgcgaggaggaggtcttcccgttg
gccatgaactacctggaccgcttcctatcgctggagcccctgaagaagagccgcctgcag
ctgctgggtgccgcctgcatgttcgtggcctccaagatgaaggagaccattcccctgact
gccgagaagttgtgcatctacaccgacaactctatccagccggaggagctgctgcaaatg
gaactgcttctggtgaacaagctcaaatggaacctggccgccatgacccctcacgatttc
atcgaacacttcctctccaaaatgccagaggctgatgagaacaagcagatcatccgcaag
catgcgcagacctttgtggccctctgtgccacagatgtgaagttcatttccaacccgccc
tccatggtggctgctgggagcgtggtggctgcgatgcaaggcctgaatctgggcagcccc
aacaacttcctctcctgctaccgcacgacgcactttctttccagagtaatcaagtgtgac
ccggactgcctccgggcctgccaggaacagattgaagcccttctggagtccagcctgcgc
caggcccaacagaacgtagaccccaaggctaccgaggaggagggggaagcggaggaagag
gcgggtctggcctgcacacccactgacgtgagagacgtgaacatctga

DBGET integrated database retrieval system