KEGG   Meriones unguiculatus (Mongolian gerbil): 110547040
Entry
110547040         CDS       T05884                                 

Gene name
Smurf2
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2 isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04120  Ubiquitin mediated proteolysis
mun04144  Endocytosis
mun04340  Hedgehog signaling pathway
mun04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110547040 (Smurf2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110547040 (Smurf2)
   04350 TGF-beta signaling pathway
    110547040 (Smurf2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110547040 (Smurf2)
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     110547040 (Smurf2)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    110547040 (Smurf2)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110547040 (Smurf2)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  HECT type E3
   110547040 (Smurf2)
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    110547040 (Smurf2)
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 110547040
NCBI-ProteinID: XP_021489960
LinkDB
Position
Unknown
AA seq 747 aa
MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINLLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCFVDENTPITGTNGATCGQSSDPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQVVSLCPDDTE
CLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKR
LMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLS
YFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDI
TGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVSEENKKEYVRLYVNWRFLRGIEAQFLAL
QKGFNEVIPQHLLKTFDEKELELIICGLGKIDVSDWKVNTRLKHCTPDSNVVKWFWKAVE
FFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRID
IPPYESYEKLYEKLLTAIEETCGFAVE
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgtctaaccccggaggccggaggaacgggcccgtcaagctgcgcctgacagtactctgt
gcaaaaaacttggtgaaaaaggattttttccgactccctgatccatttgctaaggtggta
gttgatggttctgggcagtgccattctacagatactgtgaagaacacacttgatccaaag
tggaatcagcactatgacctgtatattggaaagtctgattcagttacgatcagcgtatgg
aatcataagaagatccataagaagcaaggtgctggatttcttggttgtgttcgtcttctg
tccaatgccatcaacctcctcaaagacactggttatcagaggttggatctatgcaaactg
gggccaaatgacaatgatacagtccgaggacagattgtagtaagtcttcagtccagagac
cgaataggcactggaggacaagttgtggattgcagtcgtttgtttgataatgatttacca
gatggttgggaagaaaggcggactgcttctggaagaatccagtatctaaaccacataaca
agaactacacagtgggaacgccccacacgacctgcgtcagaatattctagtcctggcaga
cctcttagctgttttgtggatgagaatactccaattactggaacaaatggtgcaacatgt
ggacagtcttcagatcccaggctggcagagagaagagtcaggtcccagcgacatagaaat
tacatgagcaggacacacttacatactcctccagacctaccagaaggctatgaacagagg
acaacacagcagggtcaggtatatttcttacatactcagactggtgtgagcacgtggcat
gatccacgagtgcctagggatcttagcaacatcaattgtgaagagctcggtcctttgcct
cctggatgggagatccgcaatactgcaacaggaagagtttattttgttgaccataacaac
agaacaacacaatttacagatcccaggctctctgctaacttgcatttagttttaaatcgt
cagaaccagttgaaagaccagcaacaacaagtagtgtccttgtgtcctgatgacactgag
tgcctgacagtgccaaggtacaagcgagacttggttcagaaactaaaaatcttgcggcaa
gaactttcccaacaacagcctcaagctggccactgccgcattgaggtgtctagggaagag
atttttgaggaatcatatcgacaggtaatgaaaatgagaccaaaagatctctggaagcga
ttaatgataaaatttcgtggagaagaaggccttgactatggaggagttgccagggaatgg
ttgtatctcctgtcgcatgaaatgttgaatccttactatggtctcttccagtattccaga
gatgatatctacacattacagatcaaccctgactctgcagttaatccggaacatttatcc
tatttccactttgtggggcgaataatgggaatggctgtattccatggacattatattgat
ggtggtttcacattgcctttttataaacagttgctcgggaagtcaattactttggacgac
atggagttagttgatccagaccttcataatagtttggtgtggatacttgaaaatgatatc
acgggtgttctggaccataccttctgtgttgaacataatgcatatggcgaaattattcag
catgaactcaaaccaaatggcaaaagtatccctgttagtgaagaaaataagaaagaatat
gtcaggctttatgtaaactggaggtttctccgaggcattgaagctcagttcctggcactg
cagaaaggattcaatgaagtcatcccgcagcatctgctgaagacatttgatgagaaggag
ctggagctcattatttgtggacttggcaaaatcgacgtgagtgactggaaagtcaacacc
cggttaaaacactgtacgccggacagcaatgttgtcaagtggttctggaaagctgtggag
tttttcgatgaggagcggcgagcgcggctactccagtttgtgacagggtcctcccgggtg
cctctgcagggcttcaaagcactacagggtgctgcaggcccacggctctttaccatacac
cagattgatgcctgcacgaacaacttgccaaaagcccacacttgcttcaatcgaatagac
attccaccctatgaaagctatgaaaagctctatgaaaagctgctaacagccatcgaagaa
acatgtggatttgctgtggaatga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110555644
Entry
110555644         CDS       T05884                                 

Gene name
Smurf1
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF1 isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04120  Ubiquitin mediated proteolysis
mun04144  Endocytosis
mun04340  Hedgehog signaling pathway
mun04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110555644 (Smurf1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110555644 (Smurf1)
   04350 TGF-beta signaling pathway
    110555644 (Smurf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110555644 (Smurf1)
Enzymes [BR:mun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     110555644 (Smurf1)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    110555644 (Smurf1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110555644 (Smurf1)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  HECT type E3
   110555644 (Smurf1)
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    110555644 (Smurf1)
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 110555644
NCBI-ProteinID: XP_021504643
LinkDB
Position
Unknown
AA seq 731 aa
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDP
KWNQHYDLYVGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRVKDTGYQRLDLCK
LNPSDTDAVRGQIVVSLQTRDRIGSGGSVVDCRGLLENEGTVYEDSGPGRPLSCLMEEPA
PYTDGTGAAAGGGNCRFVESPTQDQRLQVQRLRNPEVRGSLQTPQNRPHGHQSPELPEGY
EQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVD
HNNRTTQFTDPRLHHIMTHQCQLKEPSQPLQLPSEGSVEDEELPAQRYERDLVQKLKVLR
HELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVARE
WLYLLCHEMLNPYYGLFQYSTDNIYTLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYI
NGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRIL
QHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQK
ELELIIGGLDKIDLSDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTR
VPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLT
AVEETCGFAVE
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgtcgaaccccgggacgcgcaggaacggctccagcatcaagatccgtctgacagtatta
tgtgccaagaaccttgcaaagaaggacttcttcagactccctgacccctttgccaagatt
gtagtggacggctctgggcagtgccactcaactgacactgtgaaaaacaccttggaccca
aagtggaaccagcactatgacctgtatgttgggaagagtgactccataaccatcagcgtg
tggaaccacaagaagatccacaagaagcagggtgccggcttcctgggctgtgtgcggctg
ctctccaacgccatcagcagggtgaaagacactggctaccagcgtttggatctgtgcaaa
ctaaatccctcagatactgatgctgttcgtggccaaatagtggtcagtttacagacccga
gacagaataggcagtggcgggtcggtggtggactgcagaggactactagaaaatgaagga
acggtgtatgaagactcgggccccggaaggccactcagctgcctcatggaggaacctgct
ccgtacacagatggtaccggtgcggctgcaggaggtgggaactgcaggtttgtggagtct
cccacccaggaccagagactccaggtccagcgtctccgaaatcctgaggtccgagggtcc
ctccagacgccccagaatcgaccacatggccaccagtcaccggagctgcctgaaggctat
gagcaaaggacgacagtacagggacaagtttactttttgcacacgcagaccggcgtcagc
acgtggcacgaccccaggatccccagagaccttaacagtgtgaactgtgatgaacttggg
ccgctgcctccaggctgggaagtcagaagtacagtgtcgggaagaatctattttgtagat
cacaataataggacaacccagtttacagacccacggcttcaccacatcatgactcaccag
tgccaactcaaggagcccagccagccactgcagttgcccagcgaaggctctgtggaggat
gaggagcttcctgcccagagatatgagagagatttagtccagaagctcaaagttctcaga
catgagctctctcttcagcagccccaagcaggtcattgtcgcatagaagtttccagagaa
gaaatatttgaggagtcgtatcgccagatcatgaagatgaggccgaaagacctgaagaag
cgcctgatggtgaagttccgaggggaagaaggtttggactatggcggagtggcacgggag
tggctatatttattgtgccatgaaatgttgaatccgtattatggactcttccagtattcc
acggacaatatttacacattgcaaatcaacccagattcttctatcaaccctgaccatctg
tcttacttccactttgtgggtcgcatcatgggtctggctgtgttccatggacattacata
aacgggggcttcacagtcccattctacaagcagctcctgggaaaacccatccagctgtcg
gatctggagtcagtggacccagaactgcacaagagcttggtgtggattctagagaatgac
atcacaccagtgctggaccataccttctgtgtggagcacaatgctttcgggcggatcctt
cagcatgaactgaaacctaatggcagaaatgtgcccgtcactgaagagaataagaaggaa
tacgtccggttgtatgtaaactggaggtttatgagaggaattgaagcccagttcttagcg
cttcagaaagggtttaatgagctcattccgcaacacttactgaaaccgtttgaccagaag
gaactagagctgataataggtgggctggataagatagacctgagcgactggaagtccaac
acgcggctgaagcactgtgtggcagacagcaacatcgtcaggtggttctggcaggcggtg
gagaccttcgatgaggagaggagggccaggctcctgcaattcgtgaccgggtccacacga
gttcctctccaaggcttcaaggctctgcaaggctctacaggcgcggcagggccccgactg
ttcaccatccacctgatagacgccaacacagacaacctacccaaggcccatacctgcttt
aaccggatcgacatcccaccctatgagtcctatgagaagctctatgagaagctgctgacg
gcagtggaggagacctgtggctttgctgtggagtga

DBGET integrated database retrieval system