KEGG   Meriones unguiculatus (Mongolian gerbil): 110547163
Entry
110547163         CDS       T05884                                 

Gene name
Tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun04010  MAPK signaling pathway
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04915  Estrogen signaling pathway
mun05200  Pathways in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05223  Non-small cell lung cancer
mun05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110547163 (Tgfa)
   04012 ErbB signaling pathway
    110547163 (Tgfa)
   04014 Ras signaling pathway
    110547163 (Tgfa)
   04151 PI3K-Akt signaling pathway
    110547163 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110547163 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110547163 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110547163 (Tgfa)
   05212 Pancreatic cancer
    110547163 (Tgfa)
   05225 Hepatocellular carcinoma
    110547163 (Tgfa)
   05214 Glioma
    110547163 (Tgfa)
   05211 Renal cell carcinoma
    110547163 (Tgfa)
   05215 Prostate cancer
    110547163 (Tgfa)
   05223 Non-small cell lung cancer
    110547163 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110547163 (Tgfa)
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 110547163
NCBI-ProteinID: XP_021490203
LinkDB
Position
Unknown
AA seq 159 aa
MVPAAGQLALLALGIVSAVCQALENSTSILSDSPVAAAVVSHFNKCPDSHTQFCFHGTCR
FLVQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLITTCVLI
HCCQLRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtccccgcggccggacagctcgctctgctagcgctgggtatcgtgtcagctgtgtgc
caggctctggaaaacagcacgtccatcctgagcgactcacccgtggcagctgcagtggtg
tctcatttcaacaagtgcccagattcgcacactcagttctgcttccatggaacctgcagg
tttttggtgcaggaggagaagccagcatgtgtctgccactctgggtacgtgggtgctcgc
tgcgagcatgcggacctcctggccgtggtggctgccagccagaagaagcaggcgatcact
gccttggtggtggtctccattgtggccctggctgtcctcattaccacctgtgtgctgatc
cactgctgccagctccgcaaacactgcgagtggtgccgtgccctcgtctgcagacacgag
aagcccagcgccctcctgaagggaagaactgcttgctgccactctgagacagtggtctga

DBGET integrated database retrieval system