KEGG   Meriones unguiculatus (Mongolian gerbil): 110547249
Entry
110547249         CDS       T05884                                 

Gene name
Tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04060  Cytokine-cytokine receptor interaction
mun04068  FoxO signaling pathway
mun04144  Endocytosis
mun04218  Cellular senescence
mun04350  TGF-beta signaling pathway
mun04380  Osteoclast differentiation
mun04390  Hippo signaling pathway
mun04520  Adherens junction
mun04659  Th17 cell differentiation
mun04926  Relaxin signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05142  Chagas disease
mun05161  Hepatitis B
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05210  Colorectal cancer
mun05212  Pancreatic cancer
mun05220  Chronic myeloid leukemia
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110547249 (Tgfbr2)
   04350 TGF-beta signaling pathway
    110547249 (Tgfbr2)
   04390 Hippo signaling pathway
    110547249 (Tgfbr2)
   04068 FoxO signaling pathway
    110547249 (Tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110547249 (Tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110547249 (Tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    110547249 (Tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110547249 (Tgfbr2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110547249 (Tgfbr2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110547249 (Tgfbr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110547249 (Tgfbr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110547249 (Tgfbr2)
   05202 Transcriptional misregulation in cancer
    110547249 (Tgfbr2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110547249 (Tgfbr2)
   05212 Pancreatic cancer
    110547249 (Tgfbr2)
   05225 Hepatocellular carcinoma
    110547249 (Tgfbr2)
   05226 Gastric cancer
    110547249 (Tgfbr2)
   05220 Chronic myeloid leukemia
    110547249 (Tgfbr2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110547249 (Tgfbr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110547249 (Tgfbr2)
   05161 Hepatitis B
    110547249 (Tgfbr2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110547249 (Tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110547249 (Tgfbr2)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110547249 (Tgfbr2)
Protein kinases [BR:mun01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110547249 (Tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 110547249
NCBI-ProteinID: XP_021490334
LinkDB
Position
Unknown
AA seq 592 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSDVEMEAQKDAPIHLSCNRTIHPLKHFNSD
VMTNDNSGAVKLPQLCKFCDVRSSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDENI
TLETVCHDPSLTYHGFTLEDATSPKCIMKEKKRAGETFFMCACNMEECNDHIIFVEDYTT
SSPDLLLVIIQVTGVSLLPPLGIAIAVIIIFYCYRVHRQQKLSPAWESNKPRKLMEFSDN
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYSSWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKEYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQIVCE
TLTECWDHDPEARLTAQCVAERFSELEHPDRLSGRSCSQEKIPEDGSLNTTK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggatgtggaaatggaggcccagaaagat
gcacccatccacctaagctgtaataggaccatccacccactgaaacattttaacagcgac
gtgatgaccaatgacaacagcggtgcagtcaagcttccacagctgtgcaagttttgtgac
gtgcgatcgtccacttgtgacaaccagaagtcctgcatgagcaactgcagcatcacggcc
atctgtgagaagccgcatgaagtctgcgtggccgtgtggaggaagaatgatgagaacatt
acactggagacagtttgccatgacccctcactcacttatcacgggtttaccctggaagat
gctacttctcccaagtgtatcatgaaggaaaagaaaagggcgggtgagacgttcttcatg
tgcgcctgcaacatggaagagtgcaatgaccacatcatctttgtcgaagattacaccacc
agcagccccgacctgctgctggtcatcattcaggtgaccggcgtcagcctcctgcctcca
ctggggattgccatagccgtcatcatcatcttctactgctaccgcgtccaccggcagcag
aagctgagccctgcctgggagagcaacaaaccgcggaagctcatggagttcagcgacaac
tgcgccatcatcctggaggatgaccgctccgacatcagctccacatgcgccaacaacatc
aaccacaacacggagctgctgcccatcgagctggacacgctggtggggaagggccgcttt
gcggaggtctacaaggccaagctgaagcagaacacctccgagcagttcgagactgtggcc
gtcaagatcttcccgtacgaggaatactcttcgtggaaaacggagaaggacatcttctcg
gacatcaacctgaaacatgagaacatcctgcagttcctcacggccgaggagaggaagacg
gagctgggcaagcagtactggctgatcacagccttccacgccaagggcaacctgcaggag
tacctcacgaggcacgtcatcagctgggaggacctgaggaaactgggcagctccctggcg
cggggcatcgctcacctccacagcgaccacactccatgtgggagacccaagatgcccatc
gttcacagggacctcaagagctccaacatcctcgtgaagaatgacttgacctgctgcctg
tgtgacttcgggctgtccttgcgcctggaccctactctgtctgtcgatgacctggccaac
agtgggcaggtgggaactgcaagatacatggccccagaagttctagaatccaggatgaat
ttggaaaacgtggagtccttcaagcagacagatgtctactccatggctctggtactctgg
gaaatgacatcccgctgcaacgccgtgggagaagtgaaagagtatgaacccccgttcggt
tccaaggtgcgggagcacccctgtgtggagagcatgaaggacaatgtcctgagggaccga
ggacggccagaaatccccagcttctggctcaaccaccagggcatccagattgtgtgtgag
acgctgaccgagtgctgggaccatgaccctgaggcccgcctcacagctcagtgtgtggct
gagcgcttcagtgagctggagcacccggacaggctctccgggaggagctgctcccaggag
aagattccagaagatggctccctgaacactaccaaatag

DBGET integrated database retrieval system