KEGG   Meriones unguiculatus (Mongolian gerbil): 110547394
Entry
110547394         CDS       T05884                                 

Gene name
Dhh
Definition
(RefSeq) desert hedgehog protein
  KO
K11990  desert hedgehog
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110547394 (Dhh)
Peptidases and inhibitors [BR:mun01002]
 Cysteine peptidases
  Family C46: hedgehog family
   110547394 (Dhh)
SSDB
Motif
Pfam: HH_signal Hint Vint Peptidase_M15_3
Other DBs
NCBI-GeneID: 110547394
NCBI-ProteinID: XP_021490587
LinkDB
Position
Unknown
AA seq 396 aa
MALLGSLLPLCCLALLALSVQSCGPGRGPVGRRRYVRKQLVPLLYKQFVPSVPERTLGAS
GPAEGRVSRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDVTTSDRDRDKYGLLARLAVEAGFDWVHYESRN
HVHVSVKADNSLAVRAGGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVPTPVL
LFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPAPADFAPVFARRLRAGDSV
LAPGGGALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAAQPTGMHWYSRLLYRLAEELLG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctctgctgggcagcctgttgcccctgtgctgtctggcactgctggcgctgtctgtc
cagagctgcgggccgggccgggggccggtcggccggcggcgttacgtgcgcaagcagctt
gtgcctctgctctacaagcagtttgtgcctagtgtgccagagcggacccttggcgcgagc
gggccagcggaggggagggtctcaagggggtccgagcgcttccgggacctcgtacccaac
tacaaccccgacattatcttcaaggatgaggagaacagcggcgctgaccgcctgatgacg
gagcgctgcaaagagcgggtgaacgcgctggccatcgcggtgatgaacatgtggcccggc
gtgcgcctgcgcgtgaccgagggctgggacgaggacggccaccacgcgcaggactcgctc
cactacgagggccgcgccctggacgtcaccacgtcggaccgcgaccgcgacaagtacggc
ctgctggcgcgcctcgccgtggaggccggcttcgactgggtccactacgagtcccgcaac
cacgtccacgtgtcggtcaaagccgataactcgctggccgtgcgggccgggggctgcttc
cccggcaacgccaccgtgcgcctgcggagcggcgagcggaaggggctgcgggagctgcac
cgcggggactgggtcctggcggccgacgcggcgggccgggtggtgcccacgccggtgctg
ctcttcctggaccgcgacctgcagcgccgcgcctcgttcgtggccgtggagaccgagcgg
cccccgcgcaagctgctgctcacgccctggcacctggtgttcgccgcccgcggccccgcg
cccgcgcccgccgacttcgccccggtgttcgcgcgccgcctgcgcgccggggactcggtg
ctggcgcccggcggcggcgcgctccggccggcgcgggtggcccgcgtggcgcgcgaggag
gccgtgggcgtgttcgcgccgctcacggcgcacggcacgctgctggtcaacgacgtgctc
gcctcctgctacgccgtcctggagagccaccagtgggcgcaccgcgccttcgcgcccctg
cgcctgctgcacgcgctcggggcgctgctgcccgggggcgccgcccagcccaccggcatg
cactggtactcccgcctcctctaccgcctggcggaggagctcctgggctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110560215
Entry
110560215         CDS       T05884                                 

Gene name
Shh
Definition
(RefSeq) sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun04360  Axon guidance
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05217  Basal cell carcinoma
mun05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110560215 (Shh)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110560215 (Shh)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110560215 (Shh)
   05205 Proteoglycans in cancer
    110560215 (Shh)
  09162 Cancer: specific types
   05226 Gastric cancer
    110560215 (Shh)
   05217 Basal cell carcinoma
    110560215 (Shh)
Peptidases and inhibitors [BR:mun01002]
 Cysteine peptidases
  Family C46: hedgehog family
   110560215 (Shh)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Heparin
  Morphogens
   110560215 (Shh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 110560215
NCBI-ProteinID: XP_021511744
LinkDB
Position
Unknown
AA seq 438 aa
MPLLARCFLVVLASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFLT
FLDRDEGAKKVFYVIETREPRERLLLTAAHLLFVAPHNGSGAPGPGPSALFASRVRPGQR
VYVAAERGGDRRLLPAAVHSVTLREEAAGAYAPLTAHGTILINRVLASCYAVIEEHSWAH
RAFAPFRLAHALLAALAPSRTDGGGDGGGVPEPQPSAEGRAAGPAAGIHWYSQLLYHIGT
WLLDSETLHPLGMAVKSS
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgccgctgctggccagatgttttctggtggtccttgcttcctcgttgctggtgtgcccc
gggctggcgtgcgggcccggcagggggtttggaaagaggcggcaccccaaaaagctgacc
cctttagcctacaagcagtttatccccaacgtagccgagaagaccctaggggccagcggc
agatacgaagggaagatcacaagaaactccgagcgatttaaggaactcacccccaattac
aaccccgacatcatatttaaggatgaggaaaacacgggagcggaccggctgatgactcag
aggtgcaaagacaagctaaatgccttggccatctctgtgatgaaccagtggcctggagtg
aagttacgagtgactgaaggctgggatgaggatggccaccattcagaggagtctctgcac
tacgagggccgagcggtggacatcaccacatctgaccgggaccggagcaagtatggcatg
ctggcccgcctggctgtggaggcaggcttcgactgggtctactacgagtcgaaagcacac
atccactgctccgtgaaagcagagaactccgtggcggccaaatccggcggctgcttcccg
ggatcggccacagtgcatctggagcagggaggcaccaagctagtgaaggatctccggccc
ggagaccgcgtgctggccgccgacgaccagggccggctgctctacagcgacttcctcacc
ttcctggaccgcgacgagggcgccaagaaggttttctacgtgatcgagacccgggagcct
cgcgagcgcctgctgctcaccgccgcgcacctgctcttcgtggcgccgcacaacggctcg
ggagccccggggcccgggccgagcgcgctcttcgccagccgcgtgcgccccggccagcgc
gtgtacgtggcggccgagcgcggcggggaccgccggctgctgcctgccgccgtgcacagc
gtgacgctgcgggaggaggccgcgggcgcgtacgcgccgctcacggcgcacggcaccatc
ctcatcaaccgggtgctggcctcgtgctacgccgtcatcgaggagcacagctgggcgcac
cgggccttcgcgcccttccgcctggcgcacgcgctgctggcggcgctggcaccctcccgc
acggacggcggcggggacgggggcggcgtccccgaaccccaaccctcggcggaagggagg
gccgcagggccggcggcgggcatccactggtactcgcagctgctctaccacattggcacc
tggctgttggacagcgagaccctgcatcccttaggaatggcggtcaagtccagctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110566358
Entry
110566358         CDS       T05884                                 

Gene name
Ihh
Definition
(RefSeq) indian hedgehog protein
  KO
K11989  indian hedgehog
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
mun05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110566358 (Ihh)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110566358 (Ihh)
Peptidases and inhibitors [BR:mun01002]
 Cysteine peptidases
  Family C46: hedgehog family
   110566358 (Ihh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 110566358
NCBI-ProteinID: XP_021519872
LinkDB
Position
Unknown
AA seq 417 aa
MSPAWLRPGLRFCRLLLLLLLLLLLLLVPAARGCGPGRVVGSRRRPPRKLVPLAYKQFSP
NVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSL
AISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAG
FDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLENGARVALSSVKPGDRVLAMGE
DGNPTFSDVLIFLDREPNRLRAFQVIETQDPPRRLVLTPAHLLFIADNHTEHAAHFRATF
ASHVRPGQYVLVAGVPGLQPAQVAAVSTHVALGSYAPLTRHGTLVVEDVVASCFAAVADH
HLAQLAFWPLRLFPSLAWGSWTPSEGVHWYPRLLYRLGRLLLEESSFHPLGMSGAGS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtctcccgcctggctccggcccggactgcgcttctgtcgcctcctcctcctcctcctg
ctcctgctgctgctgctgctggtgccggcggcgcgggggtgcgggccgggccgggtggtg
ggcagccgccggaggccacctcgcaagctcgtgcctctcgcctacaagcagttcagtccc
aacgtgccggagaagaccctgggcgccagcgggcgctacgagggcaagatcgcgcgcagc
tccgagcgcttcaaggagctcacccccaactacaaccccgacatcatcttcaaggacgag
gagaacacgggggccgaccgcctcatgacccagcgctgcaaggaccgtctgaactcgctg
gccatctccgtcatgaaccagtggcccggtgtgaagctgcgggtgaccgaaggctgggat
gaagacggccatcactccgaggagtctttacactacgaggggcgcgcggtggatatcacc
acctcagaccgcgaccgaaacaagtacggactgctggcgcgcttggccgtggaggccggc
ttcgactgggtgtattacgagtccaaggcccacgtgcattgctctgtcaagtctgagcac
tcggctgctgccaagaccggcggctgctttcctgccggagcccaggtgcgcctagaaaac
ggggcgcgtgtggccctgtcatctgtgaagccaggagaccgggtgctggccatgggggag
gacgggaaccccaccttcagtgacgtgctcattttcctggaccgtgagccaaacaggctg
agagctttccaggtcatcgagacccaggaccctccacgacggctggtactcacgcctgcc
cacctgctcttcatcgctgacaatcacacggaacacgcagcccacttccgggccacattt
gccagccacgtgaggccaggccaatatgtgctggtagcaggggtgccgggcctgcagcct
gctcaggtagcagctgtgtccacccacgtagcccttgggtcctacgcgccgctcacgagg
catgggacgctggtggtggaggacgtggtagcctcctgctttgcagcggtggctgaccac
cacctggctcagttggccttttggcccctgcgactgtttcccagtttggcatggggcagc
tggaccccaagtgagggtgttcactggtaccctcggctgctctaccgcctggggcgtctc
ttgctggaagagagcagcttccatcccctgggcatgtctggggcaggaagctga

DBGET integrated database retrieval system