KEGG   Meriones unguiculatus (Mongolian gerbil): 110547501
Entry
110547501         CDS       T05884                                 

Gene name
Cul1
Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04110  Cell cycle
mun04114  Oocyte meiosis
mun04120  Ubiquitin mediated proteolysis
mun04141  Protein processing in endoplasmic reticulum
mun04310  Wnt signaling pathway
mun04340  Hedgehog signaling pathway
mun04350  TGF-beta signaling pathway
mun04710  Circadian rhythm
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110547501 (Cul1)
   04120 Ubiquitin mediated proteolysis
    110547501 (Cul1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110547501 (Cul1)
   04340 Hedgehog signaling pathway
    110547501 (Cul1)
   04350 TGF-beta signaling pathway
    110547501 (Cul1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110547501 (Cul1)
   04114 Oocyte meiosis
    110547501 (Cul1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110547501 (Cul1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110547501 (Cul1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110547501 (Cul1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mun04121]
    110547501 (Cul1)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     110547501 (Cul1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 110547501
NCBI-ProteinID: XP_021490765
LinkDB
Position
Unknown
AA seq 776 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcatcaaacagaagtcagaatcctcatggactgaagcagatcggtcttgaccagatc
tgggatgacctcagagctggaattcagcaagtatataccagacaaagcatggcaaagtcc
agatacatggaactctacactcatgtttataactactgtactagtgtgcatcagtccaac
caagcccggggggctggagtccctccttccaagtcaaaaaaggggcagactcctggggga
gctcagtttgttggcttggagttatacaagcgattgaaggagtttttgaagaattacttg
acaaatcttcttaaggatggagaagatttaatggatgagagtgtactgaagttctacacc
cagcagtgggaagattaccgattctccagcaaagtgctgaatggaatctgtgcctacctc
aatagacattgggttcgccgcgaatgtgatgaaggacgaaaaggaatatatgaaatctat
tcacttgcattggtgacatggagagattgtttgttcaggccattgaataaacaggtaaca
aatgctgtcctaaaactgatcgaaaaggaaagaaatggtgaaaccatcaatacaaggctc
ataagtggagttgtacaatcttatgtggaactggggctgaatgaagatgatgcatttgca
aagggccctacgttaacagtgtataaagaatcctttgaatctcaatttttggctgacaca
gagagattttataccagagaaagtactgaattcttgcagcagaacccagttactgaatat
atgaaaaaggctgaggctcgtttgcttgaggaacagcggagagtccaggtttacctccac
gagagcacacaagatgaactagcacggaaatgtgagcaggtccttatcgaaaaacacttg
gaaatttttcacacagagtttcagaatttgttggatgctgacaagaatgaagatttgggc
cgcatgtataatcttgtatctagaattcaggatggcctaggagaattgaaaaaactacta
gaaactcatattcataatcagggtcttgcagcaattgagaagtgtggagaagctgctcta
aatgaccccaagatgtatgtgcagacagtgctggacgttcacaaaaaatacaatgccctg
gtgatgtcagcattcaacaatgacgctggctttgtggctgcacttgataaggcttgtggt
cgcttcataaacaacaatgcagttaccaaaatggcccagtcatccagtaaatctcctgag
ctgcttgctcggtactgtgactccttgttgaagaaaagttccaagaacccagaagaggca
gaactagaagacaccctcaatcaagtgatggtggtcttcaaatacatcgaggacaaagat
gtgtttcaaaagttctatgcaaagatgcttgccaagagactggtgcatcagaacagtgcg
agtgacgatgctgaagcaagcatgatctccaaattaaagcaagcttgtggttttgagtac
acttccaaacttcagcgaatgtttcaagacattggtgtaagcaaagatctgaatgaacag
ttcaaaaagcatctaacgaattcagaaccactggacttggacttcagtattcaagtcttg
agttccggatcgtggccctttcagcagtcttgcacatttgccttgccatcagagttggag
cgcagttaccagcgatttacagctttctacgccagccgtcacagtggcagaaaattgacg
tggttgtatcagctgtccaaaggggagctagtcaccaactgcttcaaaaacagatacact
ttgcaggcgtccacgttccagatggcaatcctgcttcagtacaacacagaagatgcctat
actgtgcagcagttgactgacagcacccagattaaaatggacattttggcacaagtccta
cagattttactcaagtccaagttgctggtcttggaagatgaaaatgctaatgttgatgag
gtggaattgaagccagacaccttaataaagttatatcttggttataaaaataagaaatta
agagttaatatcaatgtaccaatgaaaacagaacagaagcaggaacaagaaactacacac
aaaaatatagaggaagaccgcaaactactgattcaggcggctattgtgagaatcatgaaa
atgaggaaagtcctgaaacaccagcagttacttggtgaagtcctcactcagctgtcctcc
aggttcaaacctcgggtcccagtgatcaagaaatgcattgatattctcatcgaaaaagag
tatctggagcgagttgatggtgaaaaggacacctacagttacttggcttaa

DBGET integrated database retrieval system