KEGG   Meriones unguiculatus (Mongolian gerbil): 110547779
Entry
110547779         CDS       T05884                                 

Gene name
Hspa2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun03040  Spliceosome
mun04010  MAPK signaling pathway
mun04141  Protein processing in endoplasmic reticulum
mun04144  Endocytosis
mun04213  Longevity regulating pathway - multiple species
mun04612  Antigen processing and presentation
mun04915  Estrogen signaling pathway
mun05020  Prion disease
mun05134  Legionellosis
mun05145  Toxoplasmosis
mun05162  Measles
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110547779 (Hspa2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110547779 (Hspa2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110547779 (Hspa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110547779 (Hspa2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110547779 (Hspa2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110547779 (Hspa2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110547779 (Hspa2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    110547779 (Hspa2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110547779 (Hspa2)
  09172 Infectious disease: viral
   05162 Measles
    110547779 (Hspa2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110547779 (Hspa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110547779 (Hspa2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mun03041]
    110547779 (Hspa2)
   03009 Ribosome biogenesis [BR:mun03009]
    110547779 (Hspa2)
   03110 Chaperones and folding catalysts [BR:mun03110]
    110547779 (Hspa2)
   04131 Membrane trafficking [BR:mun04131]
    110547779 (Hspa2)
   03051 Proteasome [BR:mun03051]
    110547779 (Hspa2)
   03029 Mitochondrial biogenesis [BR:mun03029]
    110547779 (Hspa2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110547779 (Hspa2)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110547779 (Hspa2)
Spliceosome [BR:mun03041]
 Complex B
  Other components
   Prp19 complex
    110547779 (Hspa2)
 Complex C
   Prp19-CDC5 complex
    110547779 (Hspa2)
Ribosome biogenesis [BR:mun03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110547779 (Hspa2)
Chaperones and folding catalysts [BR:mun03110]
 Heat shock proteins
  HSP70 / DNAK
   110547779 (Hspa2)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110547779 (Hspa2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110547779 (Hspa2)
Proteasome [BR:mun03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110547779 (Hspa2)
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110547779 (Hspa2)
Exosome [BR:mun04147]
 Exosomal proteins
  Proteins found in most exosomes
   110547779 (Hspa2)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Hydantoinase_A DDR CRIC_ras_sig
Other DBs
NCBI-GeneID: 110547779
NCBI-ProteinID: XP_021491245
LinkDB
Position
Unknown
AA seq 633 aa
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEI
SSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGSSGGPTIEEVD
NT seq 1902 nt   +upstreamnt  +downstreamnt
atgtccgcccgcggcccggctatcggcatcgacctgggcaccacctactcgtgcgtgggg
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggtaaccgcaccaccccc
agctacgtggccttcacggacacggagcgcctcatcggcgacgcggccaagaaccaggtg
gccatgaaccccacgaacaccatcttcgacgccaagaggctgatcgggcgcaagttcgag
gacgccacggtgcagtccgacatgaagcactggccgttccgggtggtgagcgaggggggg
aagcccaaggtgcaggtggagtacaaaggggagatgaagaccttcttcccggaggagatc
tcctccatggtcctcaccaagatgaaggagatcgccgaagcctacctggggggcaaggtg
cagagcgcggtcatcacggtgccggcctacttcaacgactcgcagcgccaggccaccaag
gacgcgggcaccatcacgggcctcaacgtgttgcgcatcatcaacgagcccacagcggcg
gccatcgcctacggcctggataagaagggctgcgccgggggcgagaagaacgtgctcatc
ttcgacctgggcggcggcacgttcgacgtgtccatcctgacgatcgaggacggcatcttc
gaggtgaagtcgacggccggcgacacccacctgggcggcgaagacttcgacaaccgcatg
gtgagccacctggcggaggagttcaagcgcaagcacaagaaggacattgggcccaacaag
cgcgccgtgcgccggctgcgcaccgcctgcgagcgcgccaagcgcaccctcagctcgtcc
acgcaggccagcatcgagatcgactcgctctacgagggcgtggacttctacacgtccatc
acccgcgcccgcttcgaggagctcaacgccgacctcttccgggggaccctggagccggtg
gagaaggcgctccgcgacgccaagctggacaagggccagatccaggagatcgtgctggtg
ggcggctccacccgcatccccaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaacccggacgaggcggtggcctacggcgccgccgtgcaggcg
gccatcctcatcggcgacaagtcggagaacgtgcaggacctgctgttgctcgacgtgacc
ccgctgtcgctcggcatcgagacggccggcggcgtcatgaccccgctcatcaagagaaac
accacgatccccaccaagcagacgcagaccttcaccacctactcggacaaccagagcagc
gtgctggtgcaggtgtacgagggcgaacgggccatgaccaaggacaataacctcctgggc
aagttcgacctgaccgggatccccccggcgccccgcggggtcccccagattgaggtcacc
ttcgacatcgacgccaacggcatcctgaacgtcaccgccgccgacaagagcaccggtaaa
gaaaacaaaatcaccatcaccaacgacaaggggcgtctgagcaaggacgacattgaccgc
atggtgcaggaggccgagcggtacaaatcggaggacgaagccaaccgcgatcgcgtggcc
gccaagaacgcggtcgagtcgtacacctacaacatcaagcagacggtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggctcgaccggaaccagatggcagaaaaagacgagtacgaacacaagcagaaa
gagctcgagagagtgtgcaacccaatcatcagcaaactttaccaaggcggtcccggcggc
ggcggctcctccggaggacccaccatcgaggaagtggactag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110552032
Entry
110552032         CDS       T05884                                 

Gene name
Hspa8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun03040  Spliceosome
mun04010  MAPK signaling pathway
mun04141  Protein processing in endoplasmic reticulum
mun04144  Endocytosis
mun04213  Longevity regulating pathway - multiple species
mun04612  Antigen processing and presentation
mun04915  Estrogen signaling pathway
mun05020  Prion disease
mun05134  Legionellosis
mun05145  Toxoplasmosis
mun05162  Measles
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110552032 (Hspa8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110552032 (Hspa8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110552032 (Hspa8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110552032 (Hspa8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110552032 (Hspa8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110552032 (Hspa8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110552032 (Hspa8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    110552032 (Hspa8)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110552032 (Hspa8)
  09172 Infectious disease: viral
   05162 Measles
    110552032 (Hspa8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110552032 (Hspa8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110552032 (Hspa8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mun03041]
    110552032 (Hspa8)
   03009 Ribosome biogenesis [BR:mun03009]
    110552032 (Hspa8)
   03110 Chaperones and folding catalysts [BR:mun03110]
    110552032 (Hspa8)
   04131 Membrane trafficking [BR:mun04131]
    110552032 (Hspa8)
   03051 Proteasome [BR:mun03051]
    110552032 (Hspa8)
   03029 Mitochondrial biogenesis [BR:mun03029]
    110552032 (Hspa8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110552032 (Hspa8)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110552032 (Hspa8)
Spliceosome [BR:mun03041]
 Complex B
  Other components
   Prp19 complex
    110552032 (Hspa8)
 Complex C
   Prp19-CDC5 complex
    110552032 (Hspa8)
Ribosome biogenesis [BR:mun03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110552032 (Hspa8)
Chaperones and folding catalysts [BR:mun03110]
 Heat shock proteins
  HSP70 / DNAK
   110552032 (Hspa8)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110552032 (Hspa8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110552032 (Hspa8)
Proteasome [BR:mun03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110552032 (Hspa8)
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110552032 (Hspa8)
Exosome [BR:mun04147]
 Exosomal proteins
  Proteins found in most exosomes
   110552032 (Hspa8)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Other DBs
NCBI-GeneID: 110552032
NCBI-ProteinID: XP_021498722
LinkDB
Position
Unknown
AA seq 646 aa
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILEKCNEIISWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgtctaagggacctgcagttggcattgatcttggcaccacctactcctgtgtgggtgtc
ttccagcatggaaaggtggaaattattgccaatgaccagggtaaccgaaccactccgagc
tatgttgcttttacggacacagaacgtctaattggggatgctgcgaaaaaccaggttgca
atgaaccccaccaacacagtttttgatgccaaacgtctgatcggacgtaggtttgatgat
gctgttgttcaatctgatatgaagcactggcccttcatggtggtgaatgatgcaggcagg
cccaaggtccaagtagaatacaaaggagagacaaaaagtttctacccagaggaagtgtcc
tctatggttctcactaagatgaaggaaattgcagaagcctaccttgggaagactgttacc
aatgctgtggtcacagtgccagcttacttcaatgactctcagcgacaggcaacaaaagat
gctggaactattgctggccttaatgtacttcgaattatcaatgaaccaactgctgctgct
attgcttatggcttagataagaaggttggagctgaaaggaacgtgctgatttttgacttg
ggaggtggtacttttgatgtgtcaatcctcacaattgaggatggcatttttgaagtgaaa
tccacagctggagacacccacttgggtggagaagactttgataaccgaatggtcaaccat
ttcattgctgagtttaaacgaaagcacaagaaggacatcagtgagaacaagagagctgtc
aggcgtctccgtactgcctgtgaacgggctaagcgcaccctctcctccagcacccaggcc
agtattgagattgattctctctatgagggaattgacttctatacctctattacccgtgct
cgatttgaggaattgaatgctgacctgttccgtggcacactggatcctgtagaaaaggcc
cttcgcgatgccaaacttgacaagtcacagattcatgacattgttctggttggtggttct
actagaatccccaagattcagaagcttctgcaagacttcttcaacgggaaagaactgaac
aagagcattaaccctgatgaagctgttgcttatggtgcagctgtccaggcagccatttta
tcgggagacaagtctgagaacgttcaggatttgttgctgttggatgtcactcctctttcc
cttggtattgaaactgctggtggagtcatgactgtcctcatcaagcgtaataccaccatt
cccaccaagcagactcagactttcaccacctactctgacaaccagcctggtgtgctcatt
caggtgtatgaaggtgaaagggccatgaccaaggataacaacctgcttggaaagtttgaa
ctcacaggcatacctccagcacctcgtggtgtccctcagattgaagtcacttttgacatt
gatgccaatggcatcctcaatgtttctgctgtagataagagcacaggaaaggagaacaag
atcaccatcaccaatgacaagggacgtttgagcaaggaagatattgagcgtatggtccaa
gaagctgagaagtacaaagctgaggatgagaagcagagagataaagtttcctctaagaat
tcactggagtcctatgccttcaacatgaaagctacagttgaagatgagaaacttcaaggc
aaaatcaatgatgaggataaacagaagattttagaaaagtgtaacgaaatcatcagttgg
ctggataagaatcagactgctgagaaggaagaatttgaacaccagcagaaagaactggag
aaagtctgcaaccccatcattaccaagctgtaccagagtgctggtggcatgcctggagga
atgcctggcggcttccctggtggaggagcacctccatctggtggtgcttcttctggcccc
accattgaagaggtggattaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110554439
Entry
110554439         CDS       T05884                                 

Gene name
Hspa6
Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock 70 kDa protein 6
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun03040  Spliceosome
mun04010  MAPK signaling pathway
mun04141  Protein processing in endoplasmic reticulum
mun04144  Endocytosis
mun04213  Longevity regulating pathway - multiple species
mun04612  Antigen processing and presentation
mun04915  Estrogen signaling pathway
mun05020  Prion disease
mun05134  Legionellosis
mun05145  Toxoplasmosis
mun05162  Measles
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110554439 (Hspa6)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110554439 (Hspa6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110554439 (Hspa6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110554439 (Hspa6)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110554439 (Hspa6)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110554439 (Hspa6)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110554439 (Hspa6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    110554439 (Hspa6)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110554439 (Hspa6)
  09172 Infectious disease: viral
   05162 Measles
    110554439 (Hspa6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110554439 (Hspa6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110554439 (Hspa6)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mun03041]
    110554439 (Hspa6)
   03009 Ribosome biogenesis [BR:mun03009]
    110554439 (Hspa6)
   03110 Chaperones and folding catalysts [BR:mun03110]
    110554439 (Hspa6)
   04131 Membrane trafficking [BR:mun04131]
    110554439 (Hspa6)
   03051 Proteasome [BR:mun03051]
    110554439 (Hspa6)
   03029 Mitochondrial biogenesis [BR:mun03029]
    110554439 (Hspa6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110554439 (Hspa6)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110554439 (Hspa6)
Spliceosome [BR:mun03041]
 Complex B
  Other components
   Prp19 complex
    110554439 (Hspa6)
 Complex C
   Prp19-CDC5 complex
    110554439 (Hspa6)
Ribosome biogenesis [BR:mun03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110554439 (Hspa6)
Chaperones and folding catalysts [BR:mun03110]
 Heat shock proteins
  HSP70 / DNAK
   110554439 (Hspa6)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110554439 (Hspa6)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110554439 (Hspa6)
Proteasome [BR:mun03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110554439 (Hspa6)
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110554439 (Hspa6)
Exosome [BR:mun04147]
 Exosomal proteins
  Proteins found in most exosomes
   110554439 (Hspa6)
SSDB
Motif
Pfam: HSP70
Other DBs
NCBI-GeneID: 110554439
NCBI-ProteinID: XP_021502783
LinkDB
Position
Unknown
AA seq 570 aa
MRFLSGWRHLRSLLVLGLTLSPLVSSTVKATPGGRHLSGGNLPNRMLTYFFEEFRRKHGE
YTLSGREPKRTLSSSTQSTLEMGSLFEGVGFYMSITPARFEELCSDLFCKPLEPVEKAPR
DAKLAKAQIHEVILVGGSTCVSKVQKRLXDFSNENISCDEFMANATAXQVAVLMDQEKVQ
DLLLLDATPLPVPADGEGVTTLIXVPTKQTHAFTTYSDDQPGFLTRSYEDHMRLLSVLKD
NNLLSNGIPPTSCGIPQIKINVVIDARGILSATAAADGSPGKVDEITITSGKGQLSKKEV
GRMTPEAEQRKAEDEIQRDSVAAKNSPEVHVFIVKSSLQEDSLRGKTXQEVLAWLERSQL
ADKECVRQRRARELICCPVFSGAGVPGGSSRAQAGQGRPGTGLITEDADGSSVSAPPEHF
RGAGKVTAADTLSSLLLVTLDLPSLERGGARPRGTPYRSGRGARWERPGGAECKRSRGWE
RRAVRRVEQATEISHWEGKRGAERVLRWWYSASKRRRLSSKRSDCPVLTLSHLLKHHYSN
SRRTARRWRQGPGRALKSELLSWATLQGRT
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgcgctttttatctgggtggaggcaccttcgatctctgctcgtgctgggcctaacacta
tctcccctggtgtcttcgaccgtgaaggctacacctggaggcagacatctaagcggaggg
aacttacccaaccggatgctgacttatttctttgaggagttccggcgcaagcatggggag
tacacactgtctgggagggagccaaagcgtacgctgtcatccagcacccagtctactttg
gagatgggctccttgttcgaaggtgtgggcttctacatgtccattactcctgcccgcttt
gaagagctgtgctctgaccttttctgcaagcccctggagcctgtggagaaggcccctaga
gatgccaagctggccaaggcccaaatccatgaggtcatcctggtgggtggttctacctgt
gtctctaaggtgcagaagcgtctttaagacttttccaatgaaaacatcagctgcgatgag
ttcatggctaatgcgactgccntgcaggtggctgtgttgatggaccaggagaaggttcag
gatctcctcctgctggatgcgactcctctccctgtcccagcagacggtgaaggggtgacc
acattaatcnctgtccctaccaaacagacccatgccttcactacttactctgacgaccag
cctgggttcctgacccgatcatatgaggatcatatgaggttgttatccgtgctgaaggat
aacaacctgctgagtaatggcatccctcccacctcatgtggcatcccccagatcaaaata
aatgttgtcatcgatgccagaggtattctgagcgccactgcggccgctgacgggagtcca
ggcaaagtggacgagatcactattaccagcggcaaaggccagctcagcaagaaggaagtg
gggaggatgactcccgaggctgaacagcgcaaggctgaggatgaaatccagagggacagc
gtggctgccaaaaactccccggaagtccacgtcttcattgtgaagagttccttgcaagaa
gacagccttaggggaaagacanntcaggaggtcctggcctggctagagcgtagccagttg
gcagacaaggaatgtgtgcgtcagaggagggcacgggagctaatctgctgccccgtcttc
tctggggctggtgttcctgggggcagcagtagggctcaagccggccaggggaggcctggt
actggcctcattactgaggatgctgacgggtcatctgtgtctgctcccccggaacacttt
cgcggagcgggaaaagtgacagcggccgacaccctttcctctctcctgctcgtcacttta
gaccttccgtctcttgagaggggcggagccaggccacggggaaccccgtaccggtccggc
cgcggggcacgctgggagcggcccggcggggctgagtgcaagcggagccggggctgggag
cgccgggctgtgaggagagtcgaacaggccacggagatctcacattgggaagggaaaaga
ggggctgagcgcgtcctgcgttggtggtatagtgcgagcaagaggcggcgactctccagt
aaacgcagcgactgtccggtccttacactctcacaccttctaaagcaccattactccaac
tctcgtcgcaccgcacggaggtggcggcagggcccgggccgagctttgaagtccgagctc
ctctcctgggccacgctgcaaggaaggacctag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110560130
Entry
110560130         CDS       T05884                                 

Gene name
Hspa1a
Definition
(RefSeq) heat shock 70 kDa protein 1A isoform X1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun03040  Spliceosome
mun04010  MAPK signaling pathway
mun04141  Protein processing in endoplasmic reticulum
mun04144  Endocytosis
mun04213  Longevity regulating pathway - multiple species
mun04612  Antigen processing and presentation
mun04915  Estrogen signaling pathway
mun05020  Prion disease
mun05134  Legionellosis
mun05145  Toxoplasmosis
mun05162  Measles
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110560130 (Hspa1a)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110560130 (Hspa1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110560130 (Hspa1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110560130 (Hspa1a)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110560130 (Hspa1a)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110560130 (Hspa1a)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110560130 (Hspa1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    110560130 (Hspa1a)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110560130 (Hspa1a)
  09172 Infectious disease: viral
   05162 Measles
    110560130 (Hspa1a)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110560130 (Hspa1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110560130 (Hspa1a)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mun03041]
    110560130 (Hspa1a)
   03009 Ribosome biogenesis [BR:mun03009]
    110560130 (Hspa1a)
   03110 Chaperones and folding catalysts [BR:mun03110]
    110560130 (Hspa1a)
   04131 Membrane trafficking [BR:mun04131]
    110560130 (Hspa1a)
   03051 Proteasome [BR:mun03051]
    110560130 (Hspa1a)
   03029 Mitochondrial biogenesis [BR:mun03029]
    110560130 (Hspa1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110560130 (Hspa1a)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110560130 (Hspa1a)
Spliceosome [BR:mun03041]
 Complex B
  Other components
   Prp19 complex
    110560130 (Hspa1a)
 Complex C
   Prp19-CDC5 complex
    110560130 (Hspa1a)
Ribosome biogenesis [BR:mun03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110560130 (Hspa1a)
Chaperones and folding catalysts [BR:mun03110]
 Heat shock proteins
  HSP70 / DNAK
   110560130 (Hspa1a)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110560130 (Hspa1a)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110560130 (Hspa1a)
Proteasome [BR:mun03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110560130 (Hspa1a)
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110560130 (Hspa1a)
Exosome [BR:mun04147]
 Exosomal proteins
  Proteins found in most exosomes
   110560130 (Hspa1a)
SSDB
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 FGGY_C
Other DBs
NCBI-GeneID: 110560130
NCBI-ProteinID: XP_021511562
LinkDB
Position
Unknown
AA seq 643 aa
MAKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVVNDGDKPKVRVSYKGESRAFYPEEIS
SMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRSGRGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRGTLEPVEKALRDAKLDKAQVHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRDRVAAKN
ALESYAFNMKSSVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKEEFVHKREELE
RVCNPIISALYQGAAGAAGPGGFGAQGPKGGSGGSGPTIEEVD
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggccaagaacacggcgatcggcatcgacctgggcaccacctactcgtgcgtgggcgtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacccccagc
tacgtggccttcacggacaccgagcggctcatcggggacgccgccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtacagtcggacatgaagcactggccgttccaggtggtgaacgacggcgacaag
cccaaggtgcgcgtgagctacaagggcgagagccgggccttctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcctacctgggccacccggtgacc
aacgcggtgatcacggtgcccgcctacttcaacgactcgcagcgccaggccaccaaggac
gcgggcgtgatcgcgggcctgaacgtgctgcggatcatcaacgagcccacggcggccgcc
atcgcctacgggctggaccgctcgggccggggggagcgcaacgtgctcatcttcgacctg
gggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggcgggcgacacgcacctgggcggggaggacttcgacaaccggctggtgagccac
ttcgtggaggagttcaagcgcaagcacaagaaggacatcagccagaacaagcgcgcggtg
cggcggctgcgcacggcgtgcgagcgcgccaagcggacgctgtcgtccagcacgcaggcc
agcctggagatcgactcgctgttcgagggcatcgacttctacacgtccatcacgcgcgcg
cgcttcgaggagctgtgctcggacctgttccgcggcacgctggagcccgtggagaaggcg
ctgcgggacgccaagctggacaaggcgcaggtccacgacctggtgctggtgggcggctcc
acgcgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggcggtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtcggagaacgtgcaggacctgctgctgctggacgtggcgccgctgtcg
ctggggctggagacggcgggcggcgtgatgacggcgctcatcaagcgcaactccaccatc
cccaccaagcagacccagatcttcaccacctactcggacaaccagcccggcgtgctgatc
caggtgtacgagggcgagcgggccatgacgcgcgacaacaacctgctgggccgcttcgag
ctcagcggcatcccgccggcgccccggggcgtgcctcagatcgaggtgaccttcgacatc
gacgccaacggcatcctcaacgtcacggccaccgacaagagcacgggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggccgagcgctacaaggcggaggacgaggtccagcgcgacagggtggccgccaagaac
gcgctcgagtcctacgccttcaacatgaagagctcggtggaggacgagggcctcaagggc
aagatcagcgaggccgacaagaagaaggtgctggacaagtgccaggaggtcatctcgtgg
ctggacgccaacacgctggccgagaaggaggagttcgtgcacaagcgcgaggagctggag
cgggtgtgcaaccccatcatcagcgcgctgtaccagggggccgcgggggccgccgggccc
gggggcttcggggcccaggggcccaagggcggctccgggggctcggggcccaccatcgag
gaggtggattag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110560143
Entry
110560143         CDS       T05884                                 

Gene name
Hspa1l
Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun03040  Spliceosome
mun04010  MAPK signaling pathway
mun04141  Protein processing in endoplasmic reticulum
mun04144  Endocytosis
mun04213  Longevity regulating pathway - multiple species
mun04612  Antigen processing and presentation
mun04915  Estrogen signaling pathway
mun05020  Prion disease
mun05134  Legionellosis
mun05145  Toxoplasmosis
mun05162  Measles
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110560143 (Hspa1l)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110560143 (Hspa1l)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110560143 (Hspa1l)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110560143 (Hspa1l)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    110560143 (Hspa1l)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110560143 (Hspa1l)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110560143 (Hspa1l)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    110560143 (Hspa1l)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110560143 (Hspa1l)
  09172 Infectious disease: viral
   05162 Measles
    110560143 (Hspa1l)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110560143 (Hspa1l)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110560143 (Hspa1l)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mun03041]
    110560143 (Hspa1l)
   03009 Ribosome biogenesis [BR:mun03009]
    110560143 (Hspa1l)
   03110 Chaperones and folding catalysts [BR:mun03110]
    110560143 (Hspa1l)
   04131 Membrane trafficking [BR:mun04131]
    110560143 (Hspa1l)
   03051 Proteasome [BR:mun03051]
    110560143 (Hspa1l)
   03029 Mitochondrial biogenesis [BR:mun03029]
    110560143 (Hspa1l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110560143 (Hspa1l)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110560143 (Hspa1l)
Spliceosome [BR:mun03041]
 Complex B
  Other components
   Prp19 complex
    110560143 (Hspa1l)
 Complex C
   Prp19-CDC5 complex
    110560143 (Hspa1l)
Ribosome biogenesis [BR:mun03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110560143 (Hspa1l)
Chaperones and folding catalysts [BR:mun03110]
 Heat shock proteins
  HSP70 / DNAK
   110560143 (Hspa1l)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110560143 (Hspa1l)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110560143 (Hspa1l)
Proteasome [BR:mun03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110560143 (Hspa1l)
Mitochondrial biogenesis [BR:mun03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110560143 (Hspa1l)
Exosome [BR:mun04147]
 Exosomal proteins
  Proteins found in most exosomes
   110560143 (Hspa1l)
SSDB
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 FGGY_C DUF1464
Other DBs
NCBI-GeneID: 110560143
NCBI-ProteinID: XP_021511585
LinkDB
Position
Unknown
AA seq 641 aa
MATNKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVLVSYKGEKKAFYPEE
ISSMVLTKMKETAEAFLGHNVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKAGHGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLFEGIDFYTSIT
RARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQKLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAA
KNALESYAFNMKSAVSDEGLKDKISEPDKKKIVEKCNEVLSWLEANQLAEKDEFDHKRKE
LESMCNPIITKLYQAGCTGPTCAPGYTPNRAATGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggctactaataaaggaatggccatcggcatcgacctgggcaccacctactcgtgcgtg
ggcgtgttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacc
cccagctacgtggccttcacggacaccgagcggctcatcggggacgccgccaagaaccag
gtggccatgaacccccagaacactgtttttgacgccaaacgtctgatcggcaggaagttt
aatgaccctgtggtgcagtcggacatgaagctttggccgtttcaagtgatcaacgaagcc
ggcaagcccaaggtgctggtgtcctacaaaggggagaagaaagccttctaccccgaggag
atctcgtccatggtgctgaccaagatgaaggagactgcagaggcctttctgggccacaat
gtcaccaacgcggtgatcacggtgcccgcctacttcaacgactcgcagcgccaggccacc
aaggacgcgggcgtgatcgcgggcctgaacgtgctgcggatcatcaacgagcccacggcg
gccgccatcgcctatggcttagataaagcaggtcacggggagcgccacgtgctcatcttc
gacctggggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgag
gtgaaggccacggcgggcgacacgcacctgggcggggaggacttcgacaaccggctggtg
agccacttcgtggaggagttcaagcgcaagcacaagaaggacatcagccagaacaagcgc
gcggtgcggcggctgcgcacggcgtgcgagcgcgccaagcggacgctgtcgtccagcacg
caggccaacctggagatcgactcgctgttcgagggcatcgacttctacacgtccatcacg
cgcgcgcgcttcgaggagctgtgcgcggacctgttccgcggcacgctggagcccgtggag
aagtctctgcgggatgccaagatggacaaggctaagatccacgacatcgttctagtgggc
ggctccacccgcatccccaaggtgcaaaaactcctccaggactattttaatggacgagat
ctcaacaagagcatcaaccccgatgaggcggtggcctacggagctgcagtccaggcagca
attttaatgggggacaaatcggaaaaggtgcaggatttgctgctgctggacgtggctccc
ctgtcgctggggctggagacggcaggcggcgtgatgacggtcctgatcaagcgcaactcc
accatccccaccaagcagacccagatcttcaccacctactcggacaaccagcccggtgtg
ctgatccaggtgtacgagggcgagcgggccatgacgcgcgacaacaacctgctgggccgc
tttgacctgactgggatcccgccggcgccccggggcgtgcctcagatcgaggtgaccttc
gacatcgacgccaacggcatcctcaacgtcacggccatggacaagagcacgggcaaggcc
aacaagatcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatg
gtgcaggaggccgagcgctacaaggcggaggacgagggccagcgggagaagatcgccgcc
aagaacgccttagagtcttacgccttcaacatgaagagtgcagtgagtgacgagggcctc
aaggacaagatcagcgagcctgacaagaagaagatagtggagaagtgcaacgaggtcctt
tcctggctggaggccaaccagctggctgagaaagatgagtttgatcataagagaaaagaa
ctggaaagcatgtgtaaccctatcatcacaaaactctatcaggcagggtgcactgggccc
acctgtgccccggggtacacacccaacagggctgccacaggcccgaccattgaggaagta
gattag

DBGET integrated database retrieval system