KEGG   Meriones unguiculatus (Mongolian gerbil): 110547815
Entry
110547815         CDS       T05884                                 

Gene name
Fbxw11
Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04114  Oocyte meiosis
mun04120  Ubiquitin mediated proteolysis
mun04218  Cellular senescence
mun04310  Wnt signaling pathway
mun04340  Hedgehog signaling pathway
mun04390  Hippo signaling pathway
mun04710  Circadian rhythm
mun05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110547815 (Fbxw11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110547815 (Fbxw11)
   04340 Hedgehog signaling pathway
    110547815 (Fbxw11)
   04390 Hippo signaling pathway
    110547815 (Fbxw11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110547815 (Fbxw11)
   04218 Cellular senescence
    110547815 (Fbxw11)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110547815 (Fbxw11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110547815 (Fbxw11)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     110547815 (Fbxw11)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     110547815 (Fbxw11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 DUF1513 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 110547815
NCBI-ProteinID: XP_021491294
LinkDB
Position
Unknown
AA seq 563 aa
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQNTSVMEDQNED
ESPKKSALWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRM
CHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVIS
EGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETI
ESNWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKTSLECLKVLTGH
TGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKD
RSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTL
NGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSG
AYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDF
LNVPPSAQNETRSPSRTYTYISR
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaagacaagaccatcgagcttatgtgttctgtgccaagg
tctttgtggctaggctgcgccaacctggtagagagcatgtgcgcactgagttgcctgcag
agcatgcccagtgtcagatgtctccagaatacttcagttatggaagatcaaaatgaagat
gagtccccaaagaaaagtgctctttggcagataagtaacggaacatcatctgtgattgtc
tccagaaagaggccatcagaggggaactaccagaaagaaaaggacttgtgcattaagtac
tttgaccagtggtctgaatcagatcaggtggaatttgtggagcatcttatctcacgaatg
tgtcattatcagcatggacatattaactcttacctgaaacccatgttgcagcgggacttt
atcactgctttaccagagcaaggtttagatcacatagcagaaaacattctttcctacctg
gatgcccggtccctgtgtgcagcagagctggtgtgtaaagaatggcagcgagtgatctca
gaagggatgctttggaagaaactcattgagaggatggtgcgcaccgaccctctctggaag
ggactctcagaaagaagaggctgggatcagtacctgtttaaaaacagacccacagatggc
cctcccaattcattttacagatcattatacccaaagattatccaggacatagagaccata
gaatcaaactggcggtgtggacgacacaacttgcagaggattcagtgccgctctgaaaat
agtaagggtgtctactgtttgcagtatgatgatgacaaaattatcagtggcctccgggac
aactctatcaagatctgggataaaaccagcctggaatgtttgaaagtgctaacaggacac
acaggctctgtcctctgcctccagtatgatgaacgagtcattgtaactggttcttcagat
tccacagtgagagtctgggatgtgaacactggagaagttctcaacacacttatccatcac
aatgaagctgtactacacttacgcttcagcaatggactgatggtgacatgttccaaggac
cgttccattgctgtgtgggacatggcttctgccaccgatatcactttacgccgtgtcctg
gttggccaccgtgctgctgtcaatgtagtagactttgatgacaagtacattgtgtctgcc
tctggagacaggaccattaaagtgtggagcaccagcacctgtgagtttgttcgcactctg
aatgggcataagcgaggcatcgcctgtctgcagtaccgggaccggctggttgttagtgga
tcatcagataataccatccggctatgggatattgaatgtggtgcctgtttaagagtccta
gaggggcacgaagaattggtccgatgcatccgttttgataacaagaggattgtcagtggc
gcctatgatgggaagattaaagtctgggacttacaagctgctcttgaccctcgtgcccca
gcaagcacattgtgtctgcgcaccttggtggaacactctggacgtgtgtttcggctgcag
tttgatgagtttcaaatcattagcagctcccatgatgacactattttgatttgggatttt
ttaaacgtgcctcccagtgcccagaatgagacacgctctccttccagaacttacacctac
atctccagatag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110556200
Entry
110556200         CDS       T05884                                 

Gene name
Btrc
Definition
(RefSeq) F-box/WD repeat-containing protein 1A isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04114  Oocyte meiosis
mun04120  Ubiquitin mediated proteolysis
mun04218  Cellular senescence
mun04310  Wnt signaling pathway
mun04340  Hedgehog signaling pathway
mun04390  Hippo signaling pathway
mun04710  Circadian rhythm
mun05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110556200 (Btrc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110556200 (Btrc)
   04340 Hedgehog signaling pathway
    110556200 (Btrc)
   04390 Hippo signaling pathway
    110556200 (Btrc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110556200 (Btrc)
   04218 Cellular senescence
    110556200 (Btrc)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110556200 (Btrc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110556200 (Btrc)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     110556200 (Btrc)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     110556200 (Btrc)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box WD40_like Nup160 F-box_5 DUF4508
Other DBs
NCBI-GeneID: 110556200
NCBI-ProteinID: XP_021505509
LinkDB
Position
Unknown
AA seq 593 aa
MDPAEAVLQEKALKFMAAVPAGGYWRNNKKCSMPRSLWLGCSSLADSMPSLRCLYNPGTG
ALTAFQTYNSCARLCINQETVCLTSTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEK
EKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHI
AENILSYLDARSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYL
FKNKPPDENAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYD
DQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNA
GEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVV
DFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWD
IECGACLRVLEGHEELVRCIRFDSKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLV
EHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAEPPRSPSRTYTYISR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggacccggcagaggcggtgctgcaagagaaagcgctcaagtttatggctgcagttccg
gctggtggatattggaggaataataaaaagtgctctatgcccaggtctctgtggctgggc
tgctccagcctggcggacagcatgccttcgctgcgatgcctgtataacccagggactggc
gcactcacagctttccagacttacaacagctgtgccaggctctgcataaaccaagagaca
gtatgtctaacaagcactgctatgaagactgaaaattgtgtggccaaaactaaacttgcc
aatggcacttccagtatgatcgtgcccaagcagcggaaactctcagcaagctatgagaag
gagaaggagctgtgcgtcaagtactttgagcagtggtcagagtctgatcaagtggaattc
gtagagcacctcatatcccaaatgtgtcattaccaacatgggcacatcaactcttatctg
aagcctatgctccagagggatttcataactgctctgccagcacggggtctggaccatatt
gctgagaacattctgtcatacttggacgccagatctctgtgtgctgccgagcttgtgtgc
aaggagtggtaccgtgtgacgtcggacggcatgctatggaagaagctcatcgagaggatg
gtcaggacagactctctgtggcgaggcctggcggagcgcagagggtggggacagtactta
ttcaaaaacaaacctcctgatgagaatgctcctcccaactctttttatagagcactttat
cctaaaattatacaagatattgagacaatagaatccaattggagatgtggacggcatagt
ttacagagaatccactgccgaagtgaaacaagcaaaggagtttactgtttacagtatgat
gaccagaaaatagtaagcggccttcgagacaacaccatcaagatctgggataaaagcaca
ttggaatgcaagcgaattctcacaggccacacaggctctgtcctgtgtctccagtatgat
gagagagtgatcataactgggtcgtcagattccactgtcagagtgtgggatgtgaatgca
ggcgagatgctcaacaccctgattcaccattgtgaggcagttctgcacttgcgcttcaat
aacggcatgatggtgacctgttccaaagaccgttccattgctgtatgggatatggcttcc
ccaactgacatcaccctcaggagggtgctggtgggacaccgagctgcggtcaacgtcgta
gactttgatgacaagtacatcgtttctgcatctggagatagaaccatcaaggtgtggaac
acaagtacctgtgaatttgtgaggaccctaaatggacacaagcgggggatcgcctgtttg
cagtacagagacaggctggtggtgagcgggtcatcggacaacaccatcagattgtgggac
atagagtgcggcgcgtgtctgcgggtattagaaggccacgaggaactggtgcgctgcatt
agatttgatagcaaaaggatagtgagtggggcctatgacggaaagatcaaagtgtgggat
cttgtggctgctttggacccccgtgctcctgcagggacgctctgtctacggacgctggtg
gagcattctggaagagttttccgactgcagtttgatgagttccagattgtcagtagctct
catgatgacaccatcctcatctgggacttcctaaacgacccggctgcccatgctgaacca
ccccgctccccttctcggacatacacctacatctccagataa

DBGET integrated database retrieval system