KEGG   Meriones unguiculatus (Mongolian gerbil): 110547836
Entry
110547836         CDS       T05884                                 

Gene name
Hhip
Definition
(RefSeq) hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04024  cAMP signaling pathway
mun04340  Hedgehog signaling pathway
mun05200  Pathways in cancer
mun05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110547836 (Hhip)
   04024 cAMP signaling pathway
    110547836 (Hhip)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110547836 (Hhip)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110547836 (Hhip)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 110547836
NCBI-ProteinID: XP_021491320
LinkDB
Position
Unknown
AA seq 698 aa
MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGARRRRCLNGNPPRRLRRRDRRMMSQLE
LLSGEVLCGGFYPRVSCCLQSDSRGLGRLENKISSATNSTECGKLLEEIKCAPCSPHSQS
LLCSPERDVLGGELALPLLCKDYCKEFFYTCRGHIPGLLQTTADEFCFYYASKDGLCFPD
FPRKQVRGPTSNYLDQMEEYEKVEEISRKHKHNCFCVQEVASGLRQPVGAVNSGDGSHRL
FILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVS
YTTNQERWAMGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLFFGPD
GFLYIVLGDGMITLDDMEEMDGLSDFTGSVLRLDTDTDLCSVPYSIPRSNPHFNSTNQPP
EVFAHGLHDPGRCAVDRQPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLE
FKPFSSGPLVGGFIYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGS
CRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIIDPKRPLVPEECRVPVQPAQ
TLTSDCSRLCRNGYCTPTGRCCCSPGWEGPFCRVAKCEPACRHGGVCVRPNKCLCKKGYL
GPQCEQVDRNMRRVARAGILDQIIDMTSYLLDLTSYIV
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgctgaagatgctctcctttaagctgctactgttggccgtcgctctgggcttcttcgaa
ggggatgccaagtttggggaaaggagcgaagggagcggagcgaggaggagaaggtgcctg
aatgggaatccccccaggcgcctgagaaggcgagaccggcggatgatgtcgcagctggag
ctgctgagcggagaggtcctgtgcggtggcttctacccaagggtatcctgctgcctgcag
agtgacagccgcggcttggggcgtctggagaacaagatctcttctgccaccaacagcaca
gaatgcggcaagttgctggaggagatcaagtgtgcgccttgctctccacactcccagagc
ctgctctgctcacctgaaagagacgtcctgggcggcgagctcgcacttccgctcctctgc
aaagattactgcaaagagtttttttatacttgtcggggccatattccaggtcttcttcaa
acaactgctgatgagttttgcttttactatgcgagcaaagatgggttgtgctttccagat
ttcccaagaaagcaagtcagaggaccaacatctaactacttggaccagatggaagaatat
gagaaagtggaagagatcagcagaaagcacaaacacaactgcttctgtgtccaggaggtt
gcgagcgggctgcggcagcctgtgggtgctgtgaacagtggggatgggtcccaccgcctc
ttcattctagagaaggaaggctatgtgaagatcctaaccccagaaggagaaattttcaag
gagccttacttggacattcacaaacttgttcaaagtggaataaagggaggagatgaaagg
ggcctgctaagccttgcattccatcccaattacaagaaaaatggaaagctgtatgtgtct
tataccaccaaccaagaacggtgggctatggggcctcacgaccacattctcagggttgtg
gaatacacagtatccaggaaaaatccccatcaggttgacctaaggacggcccgggtgttt
ctggaagtcgctgagctccacagaaagcatcttggaggacaactgttcttcggtcccgat
ggctttttgtacatcgtcctcggggacggcatgatcactctggatgacatggaagagatg
gatgggttaagtgatttcacaggctccgtgctgaggctggacacggacaccgacctgtgc
agcgtgccgtactccattccacggagcaacccccacttcaacagcaccaaccagcccccg
gaggtgtttgcccacgggctccacgacccaggcagatgcgccgtggatcgacagcctact
gatataaacatcaatctaacaatactttgctcagattccaatgggaaaaacagatcatca
gccagaattctacagataataaaagggaaagattacgaaagcgagccatcgcttttagaa
ttcaagccattcagtagtggtcctttggttggtggattcatttacagaggttgccagtct
gaaagattgtacggaagctatgtgtttggagatcgcaatgggaatttcttgacccttcag
caaagcccagtgaccaagcaatggcaagaaaagccactctgtctggggaccagtggttcc
tgccgaggctacttctcaggtcacatcttgggatttggagaagatgaattaggagaagtt
tacattttgtcaagcagtaagagcatgactcagactcacaatggaaaactctacaagatc
atagacccaaaaagacctttggtgcctgaggaatgcagagtccccgtccagcccgcacag
accctgacctcggactgctcgcggctctgtcgaaatggctactgcacccccacgggcagg
tgctgctgcagccccggctgggaaggacccttctgcagagttgccaaatgtgagccggca
tgtcgtcacggaggtgtctgtgtcagacctaacaagtgcctctgtaaaaaaggctacctc
ggtcctcagtgtgaacaagtggacagaaacatgcgcagagtggccagggcaggtattctt
gatcagatcattgacatgacatcttatttgctggatctcacaagttacattgtatag

DBGET integrated database retrieval system