KEGG   Meriones unguiculatus (Mongolian gerbil): 110547842
Entry
110547842         CDS       T05884                                 

Gene name
CUNH16orf52
Definition
(RefSeq) uncharacterized protein C16orf52 homolog isoform X1
  KO
K23663  modulator of smoothened protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110547842 (CUNH16orf52)
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I LtrA TctB
Other DBs
NCBI-GeneID: 110547842
NCBI-ProteinID: XP_021491330
LinkDB
Position
Unknown
AA seq 167 aa
MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIIMGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggataaactgaccatcatctcaggatgtctctttctggccgccgatatcttcgccatc
gccagcatcgccaacccggactggatcaacaccggggagtcggcgggagcactcaccgtg
ggccttgtgagacagtgtcaaacgatccatgggcgagaccggacctgcattcctccccga
ctgcccccagagtgggtcaccaccctgttttttatcatcatggggatcatttccttgact
gtcacatgtggtttgctggtggcgtcccactggcgaagagaagctacaaaatatgctcga
tggatagcattcactggaatgatccttttctgtatggctgccctaatatttccaatagga
ttttacatcaatgaagtcggaggtcaaccttataagttacccaacaacacagtagttggg
tcatcatatgtactttttgtcttatcgattttcttcacaatagtaggacttctgtttgct
ggcaaagtctgtttaccaggctga

DBGET integrated database retrieval system