KEGG   Meriones unguiculatus (Mongolian gerbil): 110548394
Entry
110548394         CDS       T05884                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00562  Inositol phosphate metabolism
mun01100  Metabolic pathways
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04070  Phosphatidylinositol signaling system
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04218  Cellular senescence
mun04360  Axon guidance
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04810  Regulation of actin cytoskeleton
mun04910  Insulin signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04926  Relaxin signaling pathway
mun04929  GnRH secretion
mun04930  Type II diabetes mellitus
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun04960  Aldosterone-regulated sodium reabsorption
mun04973  Carbohydrate digestion and absorption
mun05010  Alzheimer disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05100  Bacterial invasion of epithelial cells
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05142  Chagas disease
mun05146  Amoebiasis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110548394 (Pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110548394 (Pik3cb)
   04014 Ras signaling pathway
    110548394 (Pik3cb)
   04015 Rap1 signaling pathway
    110548394 (Pik3cb)
   04370 VEGF signaling pathway
    110548394 (Pik3cb)
   04630 JAK-STAT signaling pathway
    110548394 (Pik3cb)
   04668 TNF signaling pathway
    110548394 (Pik3cb)
   04066 HIF-1 signaling pathway
    110548394 (Pik3cb)
   04068 FoxO signaling pathway
    110548394 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    110548394 (Pik3cb)
   04072 Phospholipase D signaling pathway
    110548394 (Pik3cb)
   04071 Sphingolipid signaling pathway
    110548394 (Pik3cb)
   04024 cAMP signaling pathway
    110548394 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    110548394 (Pik3cb)
   04152 AMPK signaling pathway
    110548394 (Pik3cb)
   04150 mTOR signaling pathway
    110548394 (Pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110548394 (Pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    110548394 (Pik3cb)
   04218 Cellular senescence
    110548394 (Pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110548394 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    110548394 (Pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110548394 (Pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110548394 (Pik3cb)
   04613 Neutrophil extracellular trap formation
    110548394 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    110548394 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    110548394 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    110548394 (Pik3cb)
   04660 T cell receptor signaling pathway
    110548394 (Pik3cb)
   04662 B cell receptor signaling pathway
    110548394 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    110548394 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    110548394 (Pik3cb)
   04670 Leukocyte transendothelial migration
    110548394 (Pik3cb)
   04062 Chemokine signaling pathway
    110548394 (Pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110548394 (Pik3cb)
   04923 Regulation of lipolysis in adipocytes
    110548394 (Pik3cb)
   04929 GnRH secretion
    110548394 (Pik3cb)
   04915 Estrogen signaling pathway
    110548394 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    110548394 (Pik3cb)
   04917 Prolactin signaling pathway
    110548394 (Pik3cb)
   04926 Relaxin signaling pathway
    110548394 (Pik3cb)
   04935 Growth hormone synthesis, secretion and action
    110548394 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    110548394 (Pik3cb)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110548394 (Pik3cb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110548394 (Pik3cb)
  09156 Nervous system
   04725 Cholinergic synapse
    110548394 (Pik3cb)
   04722 Neurotrophin signaling pathway
    110548394 (Pik3cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110548394 (Pik3cb)
  09158 Development and regeneration
   04360 Axon guidance
    110548394 (Pik3cb)
   04380 Osteoclast differentiation
    110548394 (Pik3cb)
  09149 Aging
   04211 Longevity regulating pathway
    110548394 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    110548394 (Pik3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110548394 (Pik3cb)
   05206 MicroRNAs in cancer
    110548394 (Pik3cb)
   05205 Proteoglycans in cancer
    110548394 (Pik3cb)
   05203 Viral carcinogenesis
    110548394 (Pik3cb)
   05230 Central carbon metabolism in cancer
    110548394 (Pik3cb)
   05231 Choline metabolism in cancer
    110548394 (Pik3cb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110548394 (Pik3cb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110548394 (Pik3cb)
   05212 Pancreatic cancer
    110548394 (Pik3cb)
   05225 Hepatocellular carcinoma
    110548394 (Pik3cb)
   05226 Gastric cancer
    110548394 (Pik3cb)
   05214 Glioma
    110548394 (Pik3cb)
   05221 Acute myeloid leukemia
    110548394 (Pik3cb)
   05220 Chronic myeloid leukemia
    110548394 (Pik3cb)
   05218 Melanoma
    110548394 (Pik3cb)
   05211 Renal cell carcinoma
    110548394 (Pik3cb)
   05215 Prostate cancer
    110548394 (Pik3cb)
   05213 Endometrial cancer
    110548394 (Pik3cb)
   05224 Breast cancer
    110548394 (Pik3cb)
   05222 Small cell lung cancer
    110548394 (Pik3cb)
   05223 Non-small cell lung cancer
    110548394 (Pik3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110548394 (Pik3cb)
   05017 Spinocerebellar ataxia
    110548394 (Pik3cb)
   05020 Prion disease
    110548394 (Pik3cb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110548394 (Pik3cb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110548394 (Pik3cb)
   04932 Non-alcoholic fatty liver disease
    110548394 (Pik3cb)
   04931 Insulin resistance
    110548394 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110548394 (Pik3cb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110548394 (Pik3cb)
   05135 Yersinia infection
    110548394 (Pik3cb)
   05100 Bacterial invasion of epithelial cells
    110548394 (Pik3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110548394 (Pik3cb)
   05170 Human immunodeficiency virus 1 infection
    110548394 (Pik3cb)
   05161 Hepatitis B
    110548394 (Pik3cb)
   05160 Hepatitis C
    110548394 (Pik3cb)
   05171 Coronavirus disease - COVID-19
    110548394 (Pik3cb)
   05164 Influenza A
    110548394 (Pik3cb)
   05162 Measles
    110548394 (Pik3cb)
   05168 Herpes simplex virus 1 infection
    110548394 (Pik3cb)
   05163 Human cytomegalovirus infection
    110548394 (Pik3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110548394 (Pik3cb)
   05169 Epstein-Barr virus infection
    110548394 (Pik3cb)
   05165 Human papillomavirus infection
    110548394 (Pik3cb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110548394 (Pik3cb)
   05142 Chagas disease
    110548394 (Pik3cb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110548394 (Pik3cb)
   01524 Platinum drug resistance
    110548394 (Pik3cb)
   01522 Endocrine resistance
    110548394 (Pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110548394 (Pik3cb)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110548394 (Pik3cb)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110548394 (Pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 110548394
NCBI-ProteinID: XP_021492269
LinkDB
Position
Unknown
AA seq 1070 aa
MCFRSIMPPAMADILDIWAVDSQIASDGSISVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAE
KLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEDKIQSLVGLSWIDWLKHTYPPEH
ETSVLENLEDKLYGGKLIVAVHFENSQDVFSFQVSPNLNPIKINELAIQKRLTIHGKEDE
ASPYDYVLQVSGRVEYVFGEHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAI
EAAINRNSSNLPLPLPPKKTRVISHVWDNNNPFQIVLVKGNKLNTEESVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHVWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQ
TNPYAENASALHIRFPENKKQPYYYPPFDKIIEKAAEIASGDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALDNRRIGQFLFWHLRSEVHIPAVSIQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELSVEKCKYMD
SKMKPLWLVYSNRAFAEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttccgctctataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagatcgcatctgatggctccatatctgttgatttccttctgcccactggcatt
tatatccagctggaagtaccccgggaagccaccatttcttatattaaacagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggacattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatacgaggaacttgaagacgaaacacgaagactttgt
gatgttagaccttttcttccagttctcaaactagtgactagaagttgtgacccagcagaa
aaattggactcaaaaattggagtccttattggaaaaggtcttcatgaatttgatgccttg
aaggatcctgaagtgaatgaatttagaagaaaaatgcgcaaattcagtgaggacaagatt
cagtctctagtggggctgtcttggattgactggctaaagcacacgtacccccctgagcat
gagacatctgtcctggagaacttggaagataaactttacggaggaaagctgatcgtagct
gtgcattttgaaaatagccaggatgtatttagttttcaagtgtctcccaatttgaatcct
ataaaaataaatgaattagcaatccagaaacgcttgactattcatggaaaggaagatgaa
gctagcccctacgactatgtgttacaagtcagtgggagagtggagtatgtatttggcgag
cacccactaattcagttccagtatatccgaaattgtgtaatgaataggaccctgccccat
ttcattcttgtggaatgttgtaagatcaagaaaatgtatgagcaagaaatgattgctata
gaggctgccatcaaccgaaactcatccaaccttcctctccctttaccaccaaagaaaaca
cgagttatttcccatgtttgggacaacaacaaccctttccaaattgtcttggtgaaagga
aataagcttaacacagaagaatccgtaaaagtccacgtcagagcaggtctcttccatgga
actgagctcctgtgcaaaaccgtcgtaagctcagagatctcaggaaaaaatgaccatgtt
tggaatgaacagctggaatttgatattaatatttgtgacttaccgagaatggctcgatta
tgttttgctgtttatgcagttttggataaagtaaaaacgaagaaatcaacaaaaaccatt
aatccctctaaatatcagaccatcaggaaagctgggaaagtgcactatcctgtagcatgg
gtaaatacgatggtttttgacttcaaagggcagctgaggtctggagacgtaatactgcac
agctggtcttcatttcctgatgagctggaagaaatgctgaatcccatgggaactgtccag
acgaacccgtatgctgagaacgcgagtgccttgcatattaggttcccagagaataaaaag
cagccttattactaccctccctttgataagatcatcgagaaggcagctgagattgccagc
ggagacagtgctaatgtgtcaagtcgcggtggaaaaaaatttctggctgtactgaaagaa
atcttggacagggaccccctgtctcagctgtgtgagaatgaaatggatctcatctggact
ctacggcaagactgccgagaaaatttcccacagtcactgccaaaactcctcttgtcaatc
aagtggaataaacttgaagatgttgctcagcttcaagccctcctgcagatttggcccaaa
ctaccccccagggaagcactggagctcctagatttcaactatccagaccagtacgtccgg
gagtatgctgtaggctgcctgcgacagatgagtgatgaagaactttctcagtatctttta
caattggtgcaagttttgaaatacgagccttttcttgattgtgccctctctagattctta
ttagaaagagcacttgataaccggaggatcgggcagtttctattttggcatcttaggtca
gaggtgcatattccagccgtgtccatacagttcggtgtcatcctggaagcgtactgtcgc
ggaagtgtaggccacatgaaagtactttccaagcaggttgaagcactcaataagttgaaa
accttaaatagcttaatcaagttaaatgcgatgaagctgaacagagctaaagggaaggag
gccatgcatacttgcttgaaacagaacgcttaccgggaggccctctccgatctgcagtca
cctctgaacccatgtgtcatcctctcagaactctctgtggaaaagtgcaagtacatggac
tccaagatgaagccattatggctggtctacagcaatagagcgtttgcagaggactctgtt
ggggtgatctttaaaaatggcgatgatttgcggcaggacatgctgacactgcagatgctg
cgcctgatggacctgctctggaaagaggccggcctggaccttcggatgctcccctatggc
tgcttagcaacaggagatcgctctggcctcatcgaggttgtgagcacctctgagacaatc
gctgacattcagctgaacagtagcaacgtggctgccacagcagccttcaacaaagacgcg
ctcctgaactggctcaaggagtacaattctggggatgacctggaccgagcgattgaggag
ttcaccctgtcctgtgctggctactgtgtagcttcttacgtccttggtatcggtgacagg
cacagcgacaacatcatggtgaaaaaaactggccagctcttccacatagattttggacat
attcttggaaatttcaaatctaaatttggcattaaaagggagcgagtaccctttattctt
acatatgacttcattcacgttattcaacaaggaaaaactggtaacacagaaaaatttggc
aggtttcgccagtgctgtgaagacgcttatctgattttacggcggcatgggaatctcttc
atcactctctttgcactgatgttgactgcggggcttcctgagctcacatcagtcaaagac
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcag
tttaaacagaagtttgatgaggcgctcagggaaagctggactactaaggtgaactggatg
gctcacacagtccggaaagactacaggtcttag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110549145
Entry
110549145         CDS       T05884                                 

Gene name
Pik3r2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04070  Phosphatidylinositol signaling system
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04218  Cellular senescence
mun04360  Axon guidance
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04810  Regulation of actin cytoskeleton
mun04910  Insulin signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04926  Relaxin signaling pathway
mun04929  GnRH secretion
mun04930  Type II diabetes mellitus
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun04960  Aldosterone-regulated sodium reabsorption
mun04973  Carbohydrate digestion and absorption
mun05010  Alzheimer disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05100  Bacterial invasion of epithelial cells
mun05135  Yersinia infection
mun05142  Chagas disease
mun05146  Amoebiasis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110549145 (Pik3r2)
   04014 Ras signaling pathway
    110549145 (Pik3r2)
   04015 Rap1 signaling pathway
    110549145 (Pik3r2)
   04370 VEGF signaling pathway
    110549145 (Pik3r2)
   04630 JAK-STAT signaling pathway
    110549145 (Pik3r2)
   04668 TNF signaling pathway
    110549145 (Pik3r2)
   04066 HIF-1 signaling pathway
    110549145 (Pik3r2)
   04068 FoxO signaling pathway
    110549145 (Pik3r2)
   04070 Phosphatidylinositol signaling system
    110549145 (Pik3r2)
   04072 Phospholipase D signaling pathway
    110549145 (Pik3r2)
   04071 Sphingolipid signaling pathway
    110549145 (Pik3r2)
   04024 cAMP signaling pathway
    110549145 (Pik3r2)
   04151 PI3K-Akt signaling pathway
    110549145 (Pik3r2)
   04152 AMPK signaling pathway
    110549145 (Pik3r2)
   04150 mTOR signaling pathway
    110549145 (Pik3r2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110549145 (Pik3r2)
  09143 Cell growth and death
   04210 Apoptosis
    110549145 (Pik3r2)
   04218 Cellular senescence
    110549145 (Pik3r2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110549145 (Pik3r2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110549145 (Pik3r2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110549145 (Pik3r2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110549145 (Pik3r2)
   04613 Neutrophil extracellular trap formation
    110549145 (Pik3r2)
   04620 Toll-like receptor signaling pathway
    110549145 (Pik3r2)
   04625 C-type lectin receptor signaling pathway
    110549145 (Pik3r2)
   04650 Natural killer cell mediated cytotoxicity
    110549145 (Pik3r2)
   04660 T cell receptor signaling pathway
    110549145 (Pik3r2)
   04662 B cell receptor signaling pathway
    110549145 (Pik3r2)
   04664 Fc epsilon RI signaling pathway
    110549145 (Pik3r2)
   04666 Fc gamma R-mediated phagocytosis
    110549145 (Pik3r2)
   04670 Leukocyte transendothelial migration
    110549145 (Pik3r2)
   04062 Chemokine signaling pathway
    110549145 (Pik3r2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110549145 (Pik3r2)
   04923 Regulation of lipolysis in adipocytes
    110549145 (Pik3r2)
   04929 GnRH secretion
    110549145 (Pik3r2)
   04915 Estrogen signaling pathway
    110549145 (Pik3r2)
   04914 Progesterone-mediated oocyte maturation
    110549145 (Pik3r2)
   04917 Prolactin signaling pathway
    110549145 (Pik3r2)
   04926 Relaxin signaling pathway
    110549145 (Pik3r2)
   04935 Growth hormone synthesis, secretion and action
    110549145 (Pik3r2)
   04919 Thyroid hormone signaling pathway
    110549145 (Pik3r2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110549145 (Pik3r2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110549145 (Pik3r2)
  09156 Nervous system
   04725 Cholinergic synapse
    110549145 (Pik3r2)
   04722 Neurotrophin signaling pathway
    110549145 (Pik3r2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110549145 (Pik3r2)
  09158 Development and regeneration
   04360 Axon guidance
    110549145 (Pik3r2)
   04380 Osteoclast differentiation
    110549145 (Pik3r2)
  09149 Aging
   04211 Longevity regulating pathway
    110549145 (Pik3r2)
   04213 Longevity regulating pathway - multiple species
    110549145 (Pik3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110549145 (Pik3r2)
   05206 MicroRNAs in cancer
    110549145 (Pik3r2)
   05205 Proteoglycans in cancer
    110549145 (Pik3r2)
   05203 Viral carcinogenesis
    110549145 (Pik3r2)
   05230 Central carbon metabolism in cancer
    110549145 (Pik3r2)
   05231 Choline metabolism in cancer
    110549145 (Pik3r2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110549145 (Pik3r2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110549145 (Pik3r2)
   05212 Pancreatic cancer
    110549145 (Pik3r2)
   05225 Hepatocellular carcinoma
    110549145 (Pik3r2)
   05226 Gastric cancer
    110549145 (Pik3r2)
   05214 Glioma
    110549145 (Pik3r2)
   05221 Acute myeloid leukemia
    110549145 (Pik3r2)
   05220 Chronic myeloid leukemia
    110549145 (Pik3r2)
   05218 Melanoma
    110549145 (Pik3r2)
   05211 Renal cell carcinoma
    110549145 (Pik3r2)
   05215 Prostate cancer
    110549145 (Pik3r2)
   05213 Endometrial cancer
    110549145 (Pik3r2)
   05224 Breast cancer
    110549145 (Pik3r2)
   05222 Small cell lung cancer
    110549145 (Pik3r2)
   05223 Non-small cell lung cancer
    110549145 (Pik3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110549145 (Pik3r2)
   05017 Spinocerebellar ataxia
    110549145 (Pik3r2)
   05020 Prion disease
    110549145 (Pik3r2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110549145 (Pik3r2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110549145 (Pik3r2)
   04932 Non-alcoholic fatty liver disease
    110549145 (Pik3r2)
   04931 Insulin resistance
    110549145 (Pik3r2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110549145 (Pik3r2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110549145 (Pik3r2)
   05100 Bacterial invasion of epithelial cells
    110549145 (Pik3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110549145 (Pik3r2)
   05170 Human immunodeficiency virus 1 infection
    110549145 (Pik3r2)
   05161 Hepatitis B
    110549145 (Pik3r2)
   05160 Hepatitis C
    110549145 (Pik3r2)
   05171 Coronavirus disease - COVID-19
    110549145 (Pik3r2)
   05164 Influenza A
    110549145 (Pik3r2)
   05162 Measles
    110549145 (Pik3r2)
   05168 Herpes simplex virus 1 infection
    110549145 (Pik3r2)
   05163 Human cytomegalovirus infection
    110549145 (Pik3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110549145 (Pik3r2)
   05169 Epstein-Barr virus infection
    110549145 (Pik3r2)
   05165 Human papillomavirus infection
    110549145 (Pik3r2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110549145 (Pik3r2)
   05142 Chagas disease
    110549145 (Pik3r2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110549145 (Pik3r2)
   01524 Platinum drug resistance
    110549145 (Pik3r2)
   01522 Endocrine resistance
    110549145 (Pik3r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110549145 (Pik3r2)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110549145 (Pik3r2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 Ribosomal_L22e SH3_1 Tai4 ATG11
Other DBs
NCBI-GeneID: 110549145
NCBI-ProteinID: XP_021493683
LinkDB
Position
Unknown
AA seq 724 aa
MAGAEGFQYRAVYPFRRERPEDLELLPGDLLVVSRVALQALGVVDGGERCPHTVGWMPGF
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPVPARPVDGPSESGLTLADLSEQFSP
PDPAPPILVKLVEAIEQAGLDSECYCKPELPAPRTDWSLSDLEQWDRTSLYDAVRGFLLA
LPTAVVTPEAATEAYRALREAVGPVGPVLEPPTLPLHQALTLRFLLQHLGRVARRAPAPG
TAVRALASVFGPLLLRTPPPPPGLDADGSEPARDLPLLLLERLVQEQVDEQDAAPPALPP
KPPKAKPAPTAVANGGSPPSLQDAEWYWGDISREEVNERLRDTPDGTFLVRDASSKIQGE
YTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVELISHYRHESLAQYNAKLDTRLLYP
VSKYQQDQVVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAF
NETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQ
DLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQRKINEWLGIKNETEDQ
YSLMEDEDALPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGD
TKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPP
PTAR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggcaggggctgagggcttccagtacagggctgtgtacccattccgccgggagcggcct
gaggacctggagctgctccctggagacctcctggtggtgagccgggtggccctgcaggcc
ctgggcgtggtggacggaggagagcgctgcccacacaccgtgggctggatgccgggcttc
aacgagcgcacccggcagcgaggggacttcccgggaacctatgtggagttcctaggaccc
gtggccctggctcgaccaggccctcgcccacgaggcccccgtcctgtgcctgccaggccc
gtggatgggccctcagagtcaggcctcacactggcagacctgtccgagcagttctcccca
cctgaccctgctccccccattctggtgaagctggtagaagccatcgagcaagcagggctg
gacagtgaatgctactgtaagccggagctgcccgcacctcggacagactggtccctgagt
gacttggaacagtgggaccgcacctccctgtacgatgctgtcaggggcttcctgctggct
ctgcctacagccgtggtgacgcctgaggccgcgacagaggcataccgggcgctgcgggag
gctgtgggtccagtggggcccgtgctggaaccgccgacgctgccactgcaccaggcgctc
acgctgcggttcctgctgcagcacctgggccgagtggcccgcagagcgcctgcgccgggc
acagctgttcgtgcactggccagtgtcttcgggcctctgctgctgcgcacgcctccgcct
cccccggggctcgatgctgatgggagcgagcctgcgcgggacttgcccctgctgctcctg
gagaggctggtgcaggagcaggtggacgagcaggacgccgcccccccagcactgccacca
aagccacccaaggccaagccggcccccaccgccgtggccaatggtgggagcccaccttca
cttcaggatgccgagtggtactggggggacatctccagggaagaggtgaatgagcggctc
cgggacacccctgacggcaccttcttggtccgagatgcatccagcaagatccagggagag
tacacgctcaccctcaggaaaggcgggaacaacaagctgatcaaagtcttccaccgggac
ggccactatggcttctcagagcccctcaccttctgctctgtggtagagctcatctcccac
taccgccatgagtcactggcccagtacaacgccaagctagacacgcgtctcctctacccc
gtgtccaagtaccagcaggaccaggtggtgaaggaggacagcgtcgaggctgtgggtgcc
cagctcaaggtctaccaccagcagtaccaggacaagagccgagagtacgaccagctctat
gaggagtacacccggacctcacaggagctccagatgaagcgcacagccatagaggccttc
aacgagaccatcaagatcttcgaggagcagggccagacacaggaaaagtgtagcaaggag
tatttggagcgcttccggcgagagggcaatgagaaggagatgcagaggatcctgctgaac
tctgagaggctcaagtctcggattgcggaaatccatgagagccgcacgaagctggagcag
gacctgcgggcgcaggcctcagacaaccgtgagattgacaagcgcatgaacagcctcaag
cccgacctcatgcagctgcgcaagatccgggaccagtaccttgtgtggctcacccagaaa
ggtgcccgacagaggaagatcaacgagtggctgggaatcaagaacgagactgaggaccag
tattcactgatggaggatgaggacgccctcccccaccacgaggagcgcacgtggtacgtg
ggcaagatcaaccgcacgcaggcagaggagatgctgagcggcaagcgggacgggaccttc
ctcatccgggagagcagccagcggggctgttacgcctgctccgtggtggtggatggcgac
acgaagcactgcgttatctaccgcacggccacgggcttcggcttcgcggagccctacaac
ctctacgggtccctgaaggagctggtgctgcactaccagcacgcatccctcgtgcagcat
aacgacgcgctcaccgtcaccctcgcgcaccccgtgcgtgcccctgggcccggcccacca
cccaccgcccgctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110553683
Entry
110553683         CDS       T05884                                 

Gene name
Pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04070  Phosphatidylinositol signaling system
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04218  Cellular senescence
mun04360  Axon guidance
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04810  Regulation of actin cytoskeleton
mun04910  Insulin signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04926  Relaxin signaling pathway
mun04929  GnRH secretion
mun04930  Type II diabetes mellitus
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun04960  Aldosterone-regulated sodium reabsorption
mun04973  Carbohydrate digestion and absorption
mun05010  Alzheimer disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05100  Bacterial invasion of epithelial cells
mun05135  Yersinia infection
mun05142  Chagas disease
mun05146  Amoebiasis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110553683 (Pik3r1)
   04014 Ras signaling pathway
    110553683 (Pik3r1)
   04015 Rap1 signaling pathway
    110553683 (Pik3r1)
   04370 VEGF signaling pathway
    110553683 (Pik3r1)
   04630 JAK-STAT signaling pathway
    110553683 (Pik3r1)
   04668 TNF signaling pathway
    110553683 (Pik3r1)
   04066 HIF-1 signaling pathway
    110553683 (Pik3r1)
   04068 FoxO signaling pathway
    110553683 (Pik3r1)
   04070 Phosphatidylinositol signaling system
    110553683 (Pik3r1)
   04072 Phospholipase D signaling pathway
    110553683 (Pik3r1)
   04071 Sphingolipid signaling pathway
    110553683 (Pik3r1)
   04024 cAMP signaling pathway
    110553683 (Pik3r1)
   04151 PI3K-Akt signaling pathway
    110553683 (Pik3r1)
   04152 AMPK signaling pathway
    110553683 (Pik3r1)
   04150 mTOR signaling pathway
    110553683 (Pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110553683 (Pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    110553683 (Pik3r1)
   04218 Cellular senescence
    110553683 (Pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110553683 (Pik3r1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110553683 (Pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110553683 (Pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110553683 (Pik3r1)
   04613 Neutrophil extracellular trap formation
    110553683 (Pik3r1)
   04620 Toll-like receptor signaling pathway
    110553683 (Pik3r1)
   04625 C-type lectin receptor signaling pathway
    110553683 (Pik3r1)
   04650 Natural killer cell mediated cytotoxicity
    110553683 (Pik3r1)
   04660 T cell receptor signaling pathway
    110553683 (Pik3r1)
   04662 B cell receptor signaling pathway
    110553683 (Pik3r1)
   04664 Fc epsilon RI signaling pathway
    110553683 (Pik3r1)
   04666 Fc gamma R-mediated phagocytosis
    110553683 (Pik3r1)
   04670 Leukocyte transendothelial migration
    110553683 (Pik3r1)
   04062 Chemokine signaling pathway
    110553683 (Pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110553683 (Pik3r1)
   04923 Regulation of lipolysis in adipocytes
    110553683 (Pik3r1)
   04929 GnRH secretion
    110553683 (Pik3r1)
   04915 Estrogen signaling pathway
    110553683 (Pik3r1)
   04914 Progesterone-mediated oocyte maturation
    110553683 (Pik3r1)
   04917 Prolactin signaling pathway
    110553683 (Pik3r1)
   04926 Relaxin signaling pathway
    110553683 (Pik3r1)
   04935 Growth hormone synthesis, secretion and action
    110553683 (Pik3r1)
   04919 Thyroid hormone signaling pathway
    110553683 (Pik3r1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110553683 (Pik3r1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110553683 (Pik3r1)
  09156 Nervous system
   04725 Cholinergic synapse
    110553683 (Pik3r1)
   04722 Neurotrophin signaling pathway
    110553683 (Pik3r1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110553683 (Pik3r1)
  09158 Development and regeneration
   04360 Axon guidance
    110553683 (Pik3r1)
   04380 Osteoclast differentiation
    110553683 (Pik3r1)
  09149 Aging
   04211 Longevity regulating pathway
    110553683 (Pik3r1)
   04213 Longevity regulating pathway - multiple species
    110553683 (Pik3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110553683 (Pik3r1)
   05206 MicroRNAs in cancer
    110553683 (Pik3r1)
   05205 Proteoglycans in cancer
    110553683 (Pik3r1)
   05203 Viral carcinogenesis
    110553683 (Pik3r1)
   05230 Central carbon metabolism in cancer
    110553683 (Pik3r1)
   05231 Choline metabolism in cancer
    110553683 (Pik3r1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110553683 (Pik3r1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110553683 (Pik3r1)
   05212 Pancreatic cancer
    110553683 (Pik3r1)
   05225 Hepatocellular carcinoma
    110553683 (Pik3r1)
   05226 Gastric cancer
    110553683 (Pik3r1)
   05214 Glioma
    110553683 (Pik3r1)
   05221 Acute myeloid leukemia
    110553683 (Pik3r1)
   05220 Chronic myeloid leukemia
    110553683 (Pik3r1)
   05218 Melanoma
    110553683 (Pik3r1)
   05211 Renal cell carcinoma
    110553683 (Pik3r1)
   05215 Prostate cancer
    110553683 (Pik3r1)
   05213 Endometrial cancer
    110553683 (Pik3r1)
   05224 Breast cancer
    110553683 (Pik3r1)
   05222 Small cell lung cancer
    110553683 (Pik3r1)
   05223 Non-small cell lung cancer
    110553683 (Pik3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110553683 (Pik3r1)
   05017 Spinocerebellar ataxia
    110553683 (Pik3r1)
   05020 Prion disease
    110553683 (Pik3r1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110553683 (Pik3r1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110553683 (Pik3r1)
   04932 Non-alcoholic fatty liver disease
    110553683 (Pik3r1)
   04931 Insulin resistance
    110553683 (Pik3r1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110553683 (Pik3r1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110553683 (Pik3r1)
   05100 Bacterial invasion of epithelial cells
    110553683 (Pik3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110553683 (Pik3r1)
   05170 Human immunodeficiency virus 1 infection
    110553683 (Pik3r1)
   05161 Hepatitis B
    110553683 (Pik3r1)
   05160 Hepatitis C
    110553683 (Pik3r1)
   05171 Coronavirus disease - COVID-19
    110553683 (Pik3r1)
   05164 Influenza A
    110553683 (Pik3r1)
   05162 Measles
    110553683 (Pik3r1)
   05168 Herpes simplex virus 1 infection
    110553683 (Pik3r1)
   05163 Human cytomegalovirus infection
    110553683 (Pik3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110553683 (Pik3r1)
   05169 Epstein-Barr virus infection
    110553683 (Pik3r1)
   05165 Human papillomavirus infection
    110553683 (Pik3r1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110553683 (Pik3r1)
   05142 Chagas disease
    110553683 (Pik3r1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110553683 (Pik3r1)
   01524 Platinum drug resistance
    110553683 (Pik3r1)
   01522 Endocrine resistance
    110553683 (Pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110553683 (Pik3r1)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110553683 (Pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Lant_dehydr_C Mod_r PI_PP_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 110553683
NCBI-ProteinID: XP_021501418
LinkDB
Position
Unknown
AA seq 727 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSEGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADTEQQAQHALVLPD
LAEQFAPPDVAPPLLIKLLEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDAASVDLEMI
DVQVLADAFKRYLSDLPNPVIPVAVYNEMMSFAQEVQSSEDYIQLLKKLLRSPNIPHQYW
LTLQYLLKHFFKLSQASSKNLLNAKVLSEIFSPLLFRFPAVSLDNNEHLVKVIENFISTE
LNERQPAPALPPKPPKPTTVANNGMNNTMSLQEAEWYWGDISREEVNEKLRDTADGTFLV
RDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYN
PKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEI
QMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISE
IIDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEW
LGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAESLLRGKRDGTFLVRESSKQGCY
ACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYP
VYAQQRR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgagtgctgaggggtaccagtacagagcgctgtacgactacaagaaggagagagaagaa
gacattgacctgcacctgggggacattctgaccgtgaataaagggtccttagtggcactt
ggattcagtgagggacaggaagcccggcctgaggagattggctggttaaatggctataat
gaaaccaccggggagaggggagactttccaggaacttacgttgaatatattggaagaaaa
agaatttcaccccccactcctaagccacgtccccctcgacctcttcctgttgcaccaggt
tcttcaaaaactgaagcagacactgagcagcaagctcagcatgctttggtccttcctgat
ctggccgagcagtttgcaccccctgacgttgccccacccctcctcatcaagctcctggaa
gccatcgagaagaaaggactggaatgttcgactctatacagaacacagagctccagcaac
cctgcagaattacgacagcttcttgattgtgatgccgcctcagtggacttggaaatgatt
gatgtacaagttttagcagatgctttcaaacgctatctctcggacttaccaaatcctgtc
attccagtagctgtttacaatgaaatgatgtcttttgcccaagaagtacaaagctctgaa
gactacatccagctgttgaagaaactccttaggtcgcctaatatacctcatcagtattgg
cttactcttcagtatttgcttaagcatttcttcaagctctctcaagcctcaagcaaaaat
cttctgaatgcgaaagtcctctctgaaattttcagccctctgcttttcagattcccagca
gtcagcttggataataatgaacacctcgtaaaagtgatagagaatttcatctcaactgaa
ttgaatgaaagacagccagcaccagcactgccccctaagccacccaagcccaccacggta
gccaacaacggcatgaacaacactatgtccttacaggaggctgaatggtactggggagac
atctcaagggaagaagtgaatgaaaaactccgagatactgctgacgggacctttttggta
cgagacgcatctactaaaatgcatggcgattatactcttacactaaggaaaggaggaaat
aacaaattaatcaaaatctttcaccgagatggaaaatacggcttctctgatccattaacc
ttcaactctgtggttgaactcataaaccactaccggaatgagtctttagcgcagtacaat
cccaagctggatgtgaagttactttacccagtgtctaaataccagcaggatcaagttgtc
aaagaagataatattgaagctgtagggaaaaagttacatgaatataatactcaattccaa
gaaaagagtcgagaatatgatagattatatgaggaatacacccgtacttcccaggaaatc
caaatgaaaagaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacaa
tgccaaacccaggagcggtacagcaaagaatacatagaaaagtttaaacgcgaaggcaac
gagaaagaaattcagaggattatgcacaattatgataagctgaagtctcgcatcagtgag
atcatagacagtagaagaagactggaggaagacctaaagaagcaggccgccgagtaccgc
gagattgacaagcgaatgaacagtattaagccagacctcattcagctgagaaagacaaga
gaccaatacttgatgtggctgacacagaaaggagttcggcagaagaagttgaatgaatgg
ttgggaaatgagaacactgaagaccaatactcgctggtagaagatgacgaggatctgccc
caccatgacgagaagacgtggaatgtgggaagcagcaacaggaacaaggctgagagtctg
ctgcgggggaaacgagacggcactttcctggtccgggagagcagtaagcagggctgctac
gcctgctctgtagtggtagatggcgaagtcaaacattgcgtcatcaacaagactgccacc
ggctatggctttgccgagccctacaacctgtacagctccctgaaggagctggtgctacac
tatcaacacacctccctcgtgcagcacaatgactccctcaatgtcacactagcataccca
gtatatgcacaacagaggcgatga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110556252
Entry
110556252         CDS       T05884                                 

Gene name
Pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00562  Inositol phosphate metabolism
mun01100  Metabolic pathways
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04070  Phosphatidylinositol signaling system
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04218  Cellular senescence
mun04360  Axon guidance
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04810  Regulation of actin cytoskeleton
mun04910  Insulin signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04926  Relaxin signaling pathway
mun04929  GnRH secretion
mun04930  Type II diabetes mellitus
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun04960  Aldosterone-regulated sodium reabsorption
mun04973  Carbohydrate digestion and absorption
mun05010  Alzheimer disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05100  Bacterial invasion of epithelial cells
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05142  Chagas disease
mun05146  Amoebiasis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110556252 (Pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110556252 (Pik3ca)
   04014 Ras signaling pathway
    110556252 (Pik3ca)
   04015 Rap1 signaling pathway
    110556252 (Pik3ca)
   04370 VEGF signaling pathway
    110556252 (Pik3ca)
   04630 JAK-STAT signaling pathway
    110556252 (Pik3ca)
   04668 TNF signaling pathway
    110556252 (Pik3ca)
   04066 HIF-1 signaling pathway
    110556252 (Pik3ca)
   04068 FoxO signaling pathway
    110556252 (Pik3ca)
   04070 Phosphatidylinositol signaling system
    110556252 (Pik3ca)
   04072 Phospholipase D signaling pathway
    110556252 (Pik3ca)
   04071 Sphingolipid signaling pathway
    110556252 (Pik3ca)
   04024 cAMP signaling pathway
    110556252 (Pik3ca)
   04151 PI3K-Akt signaling pathway
    110556252 (Pik3ca)
   04152 AMPK signaling pathway
    110556252 (Pik3ca)
   04150 mTOR signaling pathway
    110556252 (Pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110556252 (Pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    110556252 (Pik3ca)
   04218 Cellular senescence
    110556252 (Pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110556252 (Pik3ca)
   04550 Signaling pathways regulating pluripotency of stem cells
    110556252 (Pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110556252 (Pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110556252 (Pik3ca)
   04613 Neutrophil extracellular trap formation
    110556252 (Pik3ca)
   04620 Toll-like receptor signaling pathway
    110556252 (Pik3ca)
   04625 C-type lectin receptor signaling pathway
    110556252 (Pik3ca)
   04650 Natural killer cell mediated cytotoxicity
    110556252 (Pik3ca)
   04660 T cell receptor signaling pathway
    110556252 (Pik3ca)
   04662 B cell receptor signaling pathway
    110556252 (Pik3ca)
   04664 Fc epsilon RI signaling pathway
    110556252 (Pik3ca)
   04666 Fc gamma R-mediated phagocytosis
    110556252 (Pik3ca)
   04670 Leukocyte transendothelial migration
    110556252 (Pik3ca)
   04062 Chemokine signaling pathway
    110556252 (Pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110556252 (Pik3ca)
   04923 Regulation of lipolysis in adipocytes
    110556252 (Pik3ca)
   04929 GnRH secretion
    110556252 (Pik3ca)
   04915 Estrogen signaling pathway
    110556252 (Pik3ca)
   04914 Progesterone-mediated oocyte maturation
    110556252 (Pik3ca)
   04917 Prolactin signaling pathway
    110556252 (Pik3ca)
   04926 Relaxin signaling pathway
    110556252 (Pik3ca)
   04935 Growth hormone synthesis, secretion and action
    110556252 (Pik3ca)
   04919 Thyroid hormone signaling pathway
    110556252 (Pik3ca)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110556252 (Pik3ca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110556252 (Pik3ca)
  09156 Nervous system
   04725 Cholinergic synapse
    110556252 (Pik3ca)
   04722 Neurotrophin signaling pathway
    110556252 (Pik3ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110556252 (Pik3ca)
  09158 Development and regeneration
   04360 Axon guidance
    110556252 (Pik3ca)
   04380 Osteoclast differentiation
    110556252 (Pik3ca)
  09149 Aging
   04211 Longevity regulating pathway
    110556252 (Pik3ca)
   04213 Longevity regulating pathway - multiple species
    110556252 (Pik3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110556252 (Pik3ca)
   05206 MicroRNAs in cancer
    110556252 (Pik3ca)
   05205 Proteoglycans in cancer
    110556252 (Pik3ca)
   05203 Viral carcinogenesis
    110556252 (Pik3ca)
   05230 Central carbon metabolism in cancer
    110556252 (Pik3ca)
   05231 Choline metabolism in cancer
    110556252 (Pik3ca)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110556252 (Pik3ca)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110556252 (Pik3ca)
   05212 Pancreatic cancer
    110556252 (Pik3ca)
   05225 Hepatocellular carcinoma
    110556252 (Pik3ca)
   05226 Gastric cancer
    110556252 (Pik3ca)
   05214 Glioma
    110556252 (Pik3ca)
   05221 Acute myeloid leukemia
    110556252 (Pik3ca)
   05220 Chronic myeloid leukemia
    110556252 (Pik3ca)
   05218 Melanoma
    110556252 (Pik3ca)
   05211 Renal cell carcinoma
    110556252 (Pik3ca)
   05215 Prostate cancer
    110556252 (Pik3ca)
   05213 Endometrial cancer
    110556252 (Pik3ca)
   05224 Breast cancer
    110556252 (Pik3ca)
   05222 Small cell lung cancer
    110556252 (Pik3ca)
   05223 Non-small cell lung cancer
    110556252 (Pik3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110556252 (Pik3ca)
   05017 Spinocerebellar ataxia
    110556252 (Pik3ca)
   05020 Prion disease
    110556252 (Pik3ca)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110556252 (Pik3ca)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110556252 (Pik3ca)
   04932 Non-alcoholic fatty liver disease
    110556252 (Pik3ca)
   04931 Insulin resistance
    110556252 (Pik3ca)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110556252 (Pik3ca)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110556252 (Pik3ca)
   05135 Yersinia infection
    110556252 (Pik3ca)
   05100 Bacterial invasion of epithelial cells
    110556252 (Pik3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110556252 (Pik3ca)
   05170 Human immunodeficiency virus 1 infection
    110556252 (Pik3ca)
   05161 Hepatitis B
    110556252 (Pik3ca)
   05160 Hepatitis C
    110556252 (Pik3ca)
   05171 Coronavirus disease - COVID-19
    110556252 (Pik3ca)
   05164 Influenza A
    110556252 (Pik3ca)
   05162 Measles
    110556252 (Pik3ca)
   05168 Herpes simplex virus 1 infection
    110556252 (Pik3ca)
   05163 Human cytomegalovirus infection
    110556252 (Pik3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110556252 (Pik3ca)
   05169 Epstein-Barr virus infection
    110556252 (Pik3ca)
   05165 Human papillomavirus infection
    110556252 (Pik3ca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110556252 (Pik3ca)
   05142 Chagas disease
    110556252 (Pik3ca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110556252 (Pik3ca)
   01524 Platinum drug resistance
    110556252 (Pik3ca)
   01522 Endocrine resistance
    110556252 (Pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110556252 (Pik3ca)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110556252 (Pik3ca)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110556252 (Pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321
Other DBs
NCBI-GeneID: 110556252
NCBI-ProteinID: XP_021505591
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFV
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
SFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcttcaggtgaactgtggggtatccacttgatgcccccaagaatc
ctagtggaatgtttactccctaatggaatgatagtgactttagaatgcctccgtgaggct
acactaatcaccatcaaacatgaattgtttaaagaagccaggaaatacccactccatcag
cttctgcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacggctttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgtt
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtccaggacttccga
aggaacattctgaatgtttgcaaagaagccgtggacctgcgggacctcaactcgcctcac
agcagagcaatgtatgtctaccctccaaacgtcgagtcttccccagaactgccaaagcac
atctacaacaagttagataaaggacaaatcatagtggtgatttgggtaatagtctctcca
aacaatgacaagcaaaagtacactctgaagatcaaccatgactgtgtgccagagcaagtc
attgctgaagccatcaggaagaagactcggagcatgctgctgtcttctgagcagctgaaa
ctctgtgtcttagagtaccagggcaagtatattctaaaagtgtgtggctgtgacgagtac
ttcctagaaaaatatcctctgagtcagtacaagtacataagaagctgtataatgctgggg
agaatgcccaacttgatgttgatggccaaggaaagcctgtattctcagctgccgatggat
agcttcacgatgccatcgtattccaggcgcatctccacagctacaccctatatgaatgga
gagacctctacgaagtctctctgggttataaatagtgcgctcagaatcaaaattctttgt
gcaacctatgtaaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgctccaat
cctaggtggaatgaatggctgaattatgacatatacattcctgatcttcctcgcgctgct
cgcctttgcctttccatttgttctgttaaaggccgcaagggtgctaaggaggagcactgt
ccgttggcctggggaaacataaacttgtttgattacacagacaccctagtatctgggaaa
atggctttgaatctctggcctgtgccacatgggttagaagatctgctgaaccccattggt
gttactgggtcaaatccaaataaagaaactccatgcttagagttggagtttgattggttc
agcagtgtggttaagtttccagacatgtctgtgattgaagagcatgccaattggtctgtg
tcccgagaagctggattcagttactctcacacaggactgagtaacagactagccagagac
aatgagttaagagaaaatgacaaagaacagctccgagcactttgcacccgggacccactg
tctgaaatcactgaacaggaaaaagacttcctatggagccacagacactactgtgtaact
attcctgaaatcctgccaaaattgcttctgtctgtcaagtggaattccagagatgaagta
gcccagatgtactgcttagtaaaagattggcctccaatcaaaccagagcaggccatggag
ctcctcgactgtaattatccagatcctatggttcggagttttgccgttcggtgcttggaa
aaatacctaacagatgacaaactttctcagtacctcattcagcttgtacaggtcttaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaagaaagcgttgacaaat
caaaggattggccattttttcttttggcatttaaaatctgagatgcacaataagactgtc
agtcagaggtttggcctgctgttggagtcctactgccgtgcctgtgggatgtatctgaaa
cacctcaacagacaggtagaggccatggagaaactcatcaatctaactgacatcctcaag
caggagaaaaaggatgaaacacaaaaggtacagatgaagtttttggttgaacagatgaga
cagccagacttcatggatgctttgcagggttttctgtcccctctaaatcctgctcaccaa
ctaggaaacctcaggcttgaagagtgtcggattatgtcctctgcaaaaaggccactctgg
ttgaattgggagaacccagacatcatgtcagagctactgtttcagaacaatgagatcatc
tttaaaaatggcgatgatttacggcaagatatgttaacccttcagatcattcgaatcatg
gagaacatctggcaaaaccaaggccttgaccttcgcatgctgccttatggctgtctgtcc
attggggactgcgtggggcttattgaggtagtgagaaactctcacaccatcatgcagatc
cagtgcaaaggaggcctgaagggggcgctgcagttcaacagccacacactgcatcagtgg
ctcaaggacaagaacaagggcgagatatacgatgcggccattgatctgttcactcggtcg
tgcgccgggtactgtgtggcgaccttcatcttggggattggagatcggcacaatagcaac
atcatggtgaaggatgatggacagctgtttcatatagattttgggcactttttggatcac
aagaagaaaaaatttggctataaacgggaacgtgtgccatttgttctgacgcaagatttc
ttaatagtgattagtaaaggagcccaagaatacacaaagaccagagagtttgagaggttt
caggagatgtgttacaaggcttacctagcaattcggcagcatgccaatctcttcatcaac
cttttttcaatgatgcttggctctggaatgccagaactgcagtcctttgatgacattgca
tatatccgaaagactctagccctggacaaaactgagcaagaggctttggagtatttcaca
aaacagatgaatgatgcacatcatggcggctggacaacaaagatggactggatcttccac
accatcaagcagcatgcgttgaactga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110563512
Entry
110563512         CDS       T05884                                 

Gene name
Pik3r3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04070  Phosphatidylinositol signaling system
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04218  Cellular senescence
mun04360  Axon guidance
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04810  Regulation of actin cytoskeleton
mun04910  Insulin signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04926  Relaxin signaling pathway
mun04929  GnRH secretion
mun04930  Type II diabetes mellitus
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun04960  Aldosterone-regulated sodium reabsorption
mun04973  Carbohydrate digestion and absorption
mun05010  Alzheimer disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05100  Bacterial invasion of epithelial cells
mun05135  Yersinia infection
mun05142  Chagas disease
mun05146  Amoebiasis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110563512 (Pik3r3)
   04014 Ras signaling pathway
    110563512 (Pik3r3)
   04015 Rap1 signaling pathway
    110563512 (Pik3r3)
   04370 VEGF signaling pathway
    110563512 (Pik3r3)
   04630 JAK-STAT signaling pathway
    110563512 (Pik3r3)
   04668 TNF signaling pathway
    110563512 (Pik3r3)
   04066 HIF-1 signaling pathway
    110563512 (Pik3r3)
   04068 FoxO signaling pathway
    110563512 (Pik3r3)
   04070 Phosphatidylinositol signaling system
    110563512 (Pik3r3)
   04072 Phospholipase D signaling pathway
    110563512 (Pik3r3)
   04071 Sphingolipid signaling pathway
    110563512 (Pik3r3)
   04024 cAMP signaling pathway
    110563512 (Pik3r3)
   04151 PI3K-Akt signaling pathway
    110563512 (Pik3r3)
   04152 AMPK signaling pathway
    110563512 (Pik3r3)
   04150 mTOR signaling pathway
    110563512 (Pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110563512 (Pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    110563512 (Pik3r3)
   04218 Cellular senescence
    110563512 (Pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110563512 (Pik3r3)
   04550 Signaling pathways regulating pluripotency of stem cells
    110563512 (Pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110563512 (Pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110563512 (Pik3r3)
   04613 Neutrophil extracellular trap formation
    110563512 (Pik3r3)
   04620 Toll-like receptor signaling pathway
    110563512 (Pik3r3)
   04625 C-type lectin receptor signaling pathway
    110563512 (Pik3r3)
   04650 Natural killer cell mediated cytotoxicity
    110563512 (Pik3r3)
   04660 T cell receptor signaling pathway
    110563512 (Pik3r3)
   04662 B cell receptor signaling pathway
    110563512 (Pik3r3)
   04664 Fc epsilon RI signaling pathway
    110563512 (Pik3r3)
   04666 Fc gamma R-mediated phagocytosis
    110563512 (Pik3r3)
   04670 Leukocyte transendothelial migration
    110563512 (Pik3r3)
   04062 Chemokine signaling pathway
    110563512 (Pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110563512 (Pik3r3)
   04923 Regulation of lipolysis in adipocytes
    110563512 (Pik3r3)
   04929 GnRH secretion
    110563512 (Pik3r3)
   04915 Estrogen signaling pathway
    110563512 (Pik3r3)
   04914 Progesterone-mediated oocyte maturation
    110563512 (Pik3r3)
   04917 Prolactin signaling pathway
    110563512 (Pik3r3)
   04926 Relaxin signaling pathway
    110563512 (Pik3r3)
   04935 Growth hormone synthesis, secretion and action
    110563512 (Pik3r3)
   04919 Thyroid hormone signaling pathway
    110563512 (Pik3r3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110563512 (Pik3r3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110563512 (Pik3r3)
  09156 Nervous system
   04725 Cholinergic synapse
    110563512 (Pik3r3)
   04722 Neurotrophin signaling pathway
    110563512 (Pik3r3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110563512 (Pik3r3)
  09158 Development and regeneration
   04360 Axon guidance
    110563512 (Pik3r3)
   04380 Osteoclast differentiation
    110563512 (Pik3r3)
  09149 Aging
   04211 Longevity regulating pathway
    110563512 (Pik3r3)
   04213 Longevity regulating pathway - multiple species
    110563512 (Pik3r3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110563512 (Pik3r3)
   05206 MicroRNAs in cancer
    110563512 (Pik3r3)
   05205 Proteoglycans in cancer
    110563512 (Pik3r3)
   05203 Viral carcinogenesis
    110563512 (Pik3r3)
   05230 Central carbon metabolism in cancer
    110563512 (Pik3r3)
   05231 Choline metabolism in cancer
    110563512 (Pik3r3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110563512 (Pik3r3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110563512 (Pik3r3)
   05212 Pancreatic cancer
    110563512 (Pik3r3)
   05225 Hepatocellular carcinoma
    110563512 (Pik3r3)
   05226 Gastric cancer
    110563512 (Pik3r3)
   05214 Glioma
    110563512 (Pik3r3)
   05221 Acute myeloid leukemia
    110563512 (Pik3r3)
   05220 Chronic myeloid leukemia
    110563512 (Pik3r3)
   05218 Melanoma
    110563512 (Pik3r3)
   05211 Renal cell carcinoma
    110563512 (Pik3r3)
   05215 Prostate cancer
    110563512 (Pik3r3)
   05213 Endometrial cancer
    110563512 (Pik3r3)
   05224 Breast cancer
    110563512 (Pik3r3)
   05222 Small cell lung cancer
    110563512 (Pik3r3)
   05223 Non-small cell lung cancer
    110563512 (Pik3r3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110563512 (Pik3r3)
   05017 Spinocerebellar ataxia
    110563512 (Pik3r3)
   05020 Prion disease
    110563512 (Pik3r3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110563512 (Pik3r3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110563512 (Pik3r3)
   04932 Non-alcoholic fatty liver disease
    110563512 (Pik3r3)
   04931 Insulin resistance
    110563512 (Pik3r3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110563512 (Pik3r3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110563512 (Pik3r3)
   05100 Bacterial invasion of epithelial cells
    110563512 (Pik3r3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110563512 (Pik3r3)
   05170 Human immunodeficiency virus 1 infection
    110563512 (Pik3r3)
   05161 Hepatitis B
    110563512 (Pik3r3)
   05160 Hepatitis C
    110563512 (Pik3r3)
   05171 Coronavirus disease - COVID-19
    110563512 (Pik3r3)
   05164 Influenza A
    110563512 (Pik3r3)
   05162 Measles
    110563512 (Pik3r3)
   05168 Herpes simplex virus 1 infection
    110563512 (Pik3r3)
   05163 Human cytomegalovirus infection
    110563512 (Pik3r3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110563512 (Pik3r3)
   05169 Epstein-Barr virus infection
    110563512 (Pik3r3)
   05165 Human papillomavirus infection
    110563512 (Pik3r3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110563512 (Pik3r3)
   05142 Chagas disease
    110563512 (Pik3r3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110563512 (Pik3r3)
   01524 Platinum drug resistance
    110563512 (Pik3r3)
   01522 Endocrine resistance
    110563512 (Pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110563512 (Pik3r3)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110563512 (Pik3r3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Bap31_Bap29_C Transcrip_act Fez1 Cupin_8 Exonuc_VII_L
Other DBs
NCBI-GeneID: 110563512
NCBI-ProteinID: XP_021516280
LinkDB
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPLTSAVTNGMKDSCISL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKAQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKN
LQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKVRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRRIRDQHLVWLNHKGVRQKRLNAWLGIKNEDAEESYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactcatattttatattgagatggatcctccagctcttccaccaaag
ccacctaagccattgacttcagcagttacaaatggaatgaaggacagttgtatttctctt
caagacgcggaatggtactggggagatatttccagggaagaggtaaatgacaaattacgg
gacatgccagatggcaccttcttagttcgtgatgcctcaacaaaagcgcagggggactac
acgttgaccctgaggaaaggaggaaataataaactaataaagatctatcatcgggatggt
aaatatggcttctctgaccctctgacatttaattctgtggtggagctcattaaccactat
caccatgaatctcttgctcagtataatcccaaactcgatgtgaagctgatgtacccagta
tccagataccaacaggatcagttggtaaaagaagataacattgatgcagtaggtaaaaac
ctgcaagagttccactctcagtatcaggagaagagcaaagagtacgataggctgtatgaa
gagtacaccaggacgtcccaggaaatacagatgaagaggactgcaatcgaagcttttaat
gaaacgattaaaatatttgaggagcagtgccatacccaagaacaacacagtaaagaatat
attgagagatttcgcagagaggggaatgaaaaggagattgaacgaattatgatgaattat
gataaattgaaatcacgccttggtgagattcatgatagcaaagtgcgtctagagcaggac
ttgaagaaacaagctttggacaaccgggaaatagataagaaaatgaatagcatcaaacct
gacctgattcagctgcgtaggatccgtgatcagcaccttgtgtggctcaatcacaaagga
gtgaggcagaagcgcctgaatgcctggcttgggatcaagaatgaggatgctgaggaaagc
tattttatcaatgaggaagatgagaacctgccgcattatgatgagaaaacctggtttgtg
gaggatatcaaccgagtacaagcagaggacttgctctatgggaaaccagatggtgcattc
ttaattcgcgagagtagcaagaaaggatgttacgcttgttctgtggttgcggacggggaa
gtgaagcactgtgtgatctacagcactgctcgaggatatggctttgcagaaccctacaac
ctgtacagctcgctgaaggagctggtgctccattaccagcagacatccctggtccagcac
aatgactccctcaatgtcaggctcgcctaccctgtccacgcacagatgccctcactctgc
agataa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110565112
Entry
110565112         CDS       T05884                                 

Gene name
Pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00562  Inositol phosphate metabolism
mun01100  Metabolic pathways
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04070  Phosphatidylinositol signaling system
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04140  Autophagy - animal
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04152  AMPK signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04213  Longevity regulating pathway - multiple species
mun04218  Cellular senescence
mun04360  Axon guidance
mun04370  VEGF signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04670  Leukocyte transendothelial migration
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04810  Regulation of actin cytoskeleton
mun04910  Insulin signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04923  Regulation of lipolysis in adipocytes
mun04926  Relaxin signaling pathway
mun04929  GnRH secretion
mun04930  Type II diabetes mellitus
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun04960  Aldosterone-regulated sodium reabsorption
mun04973  Carbohydrate digestion and absorption
mun05010  Alzheimer disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05100  Bacterial invasion of epithelial cells
mun05132  Salmonella infection
mun05135  Yersinia infection
mun05142  Chagas disease
mun05146  Amoebiasis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05218  Melanoma
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110565112 (Pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110565112 (Pik3cd)
   04014 Ras signaling pathway
    110565112 (Pik3cd)
   04015 Rap1 signaling pathway
    110565112 (Pik3cd)
   04370 VEGF signaling pathway
    110565112 (Pik3cd)
   04630 JAK-STAT signaling pathway
    110565112 (Pik3cd)
   04668 TNF signaling pathway
    110565112 (Pik3cd)
   04066 HIF-1 signaling pathway
    110565112 (Pik3cd)
   04068 FoxO signaling pathway
    110565112 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    110565112 (Pik3cd)
   04072 Phospholipase D signaling pathway
    110565112 (Pik3cd)
   04071 Sphingolipid signaling pathway
    110565112 (Pik3cd)
   04024 cAMP signaling pathway
    110565112 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    110565112 (Pik3cd)
   04152 AMPK signaling pathway
    110565112 (Pik3cd)
   04150 mTOR signaling pathway
    110565112 (Pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110565112 (Pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    110565112 (Pik3cd)
   04218 Cellular senescence
    110565112 (Pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110565112 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    110565112 (Pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110565112 (Pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110565112 (Pik3cd)
   04613 Neutrophil extracellular trap formation
    110565112 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    110565112 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    110565112 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    110565112 (Pik3cd)
   04660 T cell receptor signaling pathway
    110565112 (Pik3cd)
   04662 B cell receptor signaling pathway
    110565112 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    110565112 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    110565112 (Pik3cd)
   04670 Leukocyte transendothelial migration
    110565112 (Pik3cd)
   04062 Chemokine signaling pathway
    110565112 (Pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110565112 (Pik3cd)
   04923 Regulation of lipolysis in adipocytes
    110565112 (Pik3cd)
   04929 GnRH secretion
    110565112 (Pik3cd)
   04915 Estrogen signaling pathway
    110565112 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    110565112 (Pik3cd)
   04917 Prolactin signaling pathway
    110565112 (Pik3cd)
   04926 Relaxin signaling pathway
    110565112 (Pik3cd)
   04935 Growth hormone synthesis, secretion and action
    110565112 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    110565112 (Pik3cd)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110565112 (Pik3cd)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110565112 (Pik3cd)
  09156 Nervous system
   04725 Cholinergic synapse
    110565112 (Pik3cd)
   04722 Neurotrophin signaling pathway
    110565112 (Pik3cd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110565112 (Pik3cd)
  09158 Development and regeneration
   04360 Axon guidance
    110565112 (Pik3cd)
   04380 Osteoclast differentiation
    110565112 (Pik3cd)
  09149 Aging
   04211 Longevity regulating pathway
    110565112 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    110565112 (Pik3cd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110565112 (Pik3cd)
   05206 MicroRNAs in cancer
    110565112 (Pik3cd)
   05205 Proteoglycans in cancer
    110565112 (Pik3cd)
   05203 Viral carcinogenesis
    110565112 (Pik3cd)
   05230 Central carbon metabolism in cancer
    110565112 (Pik3cd)
   05231 Choline metabolism in cancer
    110565112 (Pik3cd)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110565112 (Pik3cd)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110565112 (Pik3cd)
   05212 Pancreatic cancer
    110565112 (Pik3cd)
   05225 Hepatocellular carcinoma
    110565112 (Pik3cd)
   05226 Gastric cancer
    110565112 (Pik3cd)
   05214 Glioma
    110565112 (Pik3cd)
   05221 Acute myeloid leukemia
    110565112 (Pik3cd)
   05220 Chronic myeloid leukemia
    110565112 (Pik3cd)
   05218 Melanoma
    110565112 (Pik3cd)
   05211 Renal cell carcinoma
    110565112 (Pik3cd)
   05215 Prostate cancer
    110565112 (Pik3cd)
   05213 Endometrial cancer
    110565112 (Pik3cd)
   05224 Breast cancer
    110565112 (Pik3cd)
   05222 Small cell lung cancer
    110565112 (Pik3cd)
   05223 Non-small cell lung cancer
    110565112 (Pik3cd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110565112 (Pik3cd)
   05017 Spinocerebellar ataxia
    110565112 (Pik3cd)
   05020 Prion disease
    110565112 (Pik3cd)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110565112 (Pik3cd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110565112 (Pik3cd)
   04932 Non-alcoholic fatty liver disease
    110565112 (Pik3cd)
   04931 Insulin resistance
    110565112 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110565112 (Pik3cd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110565112 (Pik3cd)
   05135 Yersinia infection
    110565112 (Pik3cd)
   05100 Bacterial invasion of epithelial cells
    110565112 (Pik3cd)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110565112 (Pik3cd)
   05170 Human immunodeficiency virus 1 infection
    110565112 (Pik3cd)
   05161 Hepatitis B
    110565112 (Pik3cd)
   05160 Hepatitis C
    110565112 (Pik3cd)
   05171 Coronavirus disease - COVID-19
    110565112 (Pik3cd)
   05164 Influenza A
    110565112 (Pik3cd)
   05162 Measles
    110565112 (Pik3cd)
   05168 Herpes simplex virus 1 infection
    110565112 (Pik3cd)
   05163 Human cytomegalovirus infection
    110565112 (Pik3cd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110565112 (Pik3cd)
   05169 Epstein-Barr virus infection
    110565112 (Pik3cd)
   05165 Human papillomavirus infection
    110565112 (Pik3cd)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110565112 (Pik3cd)
   05142 Chagas disease
    110565112 (Pik3cd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110565112 (Pik3cd)
   01524 Platinum drug resistance
    110565112 (Pik3cd)
   01522 Endocrine resistance
    110565112 (Pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110565112 (Pik3cd)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110565112 (Pik3cd)
Membrane trafficking [BR:mun04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110565112 (Pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DOCK-C2
Other DBs
NCBI-GeneID: 110565112
NCBI-ProteinID: XP_021518384
LinkDB
Position
Unknown
AA seq 1046 aa
MPPGVDCPMEFWTKEESQSVAVDFLLPTGVYLNFQVSRNANLSTIKQVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWEEWLQYSFPLQLEPSARSWRA
GMLRVTNRALLVNVKFEGSEDSFTLQVSTQDMPLALMACALRKKATVFRQPLVEQPEDYA
LQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFSIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVSVSSEPVWKQRLEFDISICDLPRMARLCFALYAVVEKAKKKSTKKKSKKADCPIAWA
NLMLFDYKDQLKTGERRLYMWPSVPDDKGELLNPAGTVRSNPNTESAAALVIFLPEVAAH
PVYFPALEKILELGRHGERGRITEEEQLQLREILERRGSGELYEHEKDLMWKMRHEVQEH
FPEALARLLLVTKWNKHEDVAQLSQMLYLLCSWPELPVLSALELLDFSFPDSYVGSFAIK
SLRKLTDGELLQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVP
SVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKSLNDFVKVSSQKTTKPQAKELMHIC
MRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGSVGIIF
KNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQ
LNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDN
IMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRG
YCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVK
FNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggagttctggaccaaagaggagagccagagtgtg
gctgttgacttcctgctgcccacgggggtctacctgaacttccaggtgtcccgcaatgcc
aacctcagcaccatcaaacaggtgctgtggcaccgtgcccagtacgagccgctcttccac
atgctcagtgaccccgaggcttacgtgttcacctgcgtgaaccagacagcggagcagcag
gagttggaggatgagcagcggaggctgtgtgatatccagcccttcctgcccgtgctgcgc
ctggtggctcgagagggtgaccgcgtgaagaagctggtcaactctcagatcagcctcctc
atcggcaaaggtctccacgagtttgattccctgcgggacccggaagtgaatgacttccgc
actaagatgcgccagttctgtgaagaggccgcggctcaccgccagcagctgggctgggag
gaatggctgcagtatagcttccccctgcagctggagccctcagcgaggagctggcgggcg
ggcatgctgcgcgtcaccaaccgagccctgctggttaacgtgaaattcgagggtagtgag
gacagcttcaccttacaggtatccacccaggacatgcccctggcgctgatggcctgtgcc
ctccggaagaaggccacagtgttccggcagcctctggtggagcagcccgaggactacgcc
cttcaggtgaacgggaggcacgagtacctctatggcagctacccgctctgccagtttcag
tacatctgcagctgcctgcacagtggactaaccccccacctgaccatggtccactcctcc
tctatccttgccatgcgggatgagcagagcaaccctgccccccaagtccagaagccacgc
gccaaacctccccccatccctgctaagaagccctcctctgtgtccctgtggtccctggag
cagccgttctccattgagctgatccagggcagcaaagtgaatgcagatgagcggatgaag
ctggttgtgcaggccgggctcttccatggtaacgagatgctgtgtaagacggtatccagc
tccgaggtgagcgtgagctcagagcccgtgtggaagcagcgacttgagttcgacatcagt
atctgtgacctgccacgcatggcccgcctctgctttgccctctatgccgtcgtggagaag
gctaagaagaagtccaccaagaaaaagtccaagaaggcggactgtcccattgcctgggcc
aacctcatgctgttcgactacaaagatcagctcaagaccggggagcgccgcctctacatg
tggccctctgtcccagatgacaaaggagagctgctgaatcctgcgggcaccgtgcgcagt
aaccccaacacagagagcgctgctgccctggtcatcttcctgcccgaggtggccgcccat
cctgtctacttccctgccctggagaagatcctggagctggggcgtcacggggagcgcggg
cgcatcacggaggaggagcagctgcagctgcgggagatcctggagaggcgggggtctggg
gagctgtacgaacacgagaaggacctgatgtggaagatgcgccatgaggtccaggagcac
ttcccagaggcgctggcccgcctgctgctggtcaccaagtggaataaacatgaggatgtg
gcccagctgtcccagatgctctatttgctgtgctcctggcccgagctgcctgtgctgagt
gccctggagctgctggacttcagcttccccgactcctacgtgggctccttcgccatcaag
tccctgcggaagctgacggatggcgagcttctccagtacctcctgcagctggtgcaagtg
ctcaaatacgagtcctacctggactgcgagttgaccaaattcttgctggaccgagccctg
gccaaccgcaagatcggccactttctcttctggcaccttcgctctgagatgcatgtacca
tcagtggccctgcgctttggcctcatcatggaagcctattgcagaggcagcactcaccac
atgaaggtgctgatgaagcagggggaagcactgagcaagcttaagtcactgaatgacttc
gtgaaggtgagctctcagaagaccaccaagccccaggccaaggagctgatgcacatatgc
atgcggcaggagacctacatggaggccctgtcccacctgcagtccccgctcgaccccagc
accctgctggaggaagtctgtgtggagcagtgcaccttcatggactccaagatgaagccg
ctgtggatcatgtacagcagcgaggaggcaggcagcgctggcagcgtgggcatcatcttt
aagaacggggatgacctccgccaggatatgctgaccctgcagatgatccagctcatggac
gtcctgtggaagcaggagggcctggacctgaggatgaccccctatggctgcctccccacc
ggagaccgcacgggtctcatcgaggtggtcctccactcggacaccattgccaacatccag
ctgaacaagagcaacatggcagccacagccgccttcaacaaggatgccctgctcaactgg
ctcaaatctaagaaccctggggaggccctagatcgggccatcgaggaatttaccctctcc
tgtgctggctactgtgtggccacgtacgtgctgggcattggtgaccgacacagcgacaac
atcatgattcgagagagtgggcagctgttccacatcgattttggccactttctggggaac
ttcaagaccaagtttgggatcaaccgtgagcgcgtccccttcattctcacgtatgacttt
gtccacgtgatccagcaggggaagactaacaacagtgagaaatttgaaaggttccgtggc
tactgtgaacgagcctacaccatcctgcggcgccatgggctgctcttcctccatctcttt
gccctgatgcgtgcggcaggtctgcctgagcttagctgctccaaagatatccagtatctc
aaggactctctggcgctagggaagacggaggaagaagcgctaaagcacttccgggtgaag
ttcaacgaagctctgcgggaaagctggaaaaccaaagtcaactggctggcacacaacgtg
tccaaggacaaccggcagtaa

DBGET integrated database retrieval system