KEGG   Meriones unguiculatus (Mongolian gerbil): 110548438
Entry
110548438         CDS       T05884                                 

Gene name
Il12b
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04620  Toll-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04940  Type I diabetes mellitus
mun05133  Pertussis
mun05134  Legionellosis
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05143  African trypanosomiasis
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05321  Inflammatory bowel disease
mun05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110548438 (Il12b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110548438 (Il12b)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110548438 (Il12b)
   04622 RIG-I-like receptor signaling pathway
    110548438 (Il12b)
   04625 C-type lectin receptor signaling pathway
    110548438 (Il12b)
   04658 Th1 and Th2 cell differentiation
    110548438 (Il12b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110548438 (Il12b)
   05205 Proteoglycans in cancer
    110548438 (Il12b)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110548438 (Il12b)
   05330 Allograft rejection
    110548438 (Il12b)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110548438 (Il12b)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110548438 (Il12b)
   05134 Legionellosis
    110548438 (Il12b)
   05152 Tuberculosis
    110548438 (Il12b)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110548438 (Il12b)
   05164 Influenza A
    110548438 (Il12b)
   05162 Measles
    110548438 (Il12b)
   05168 Herpes simplex virus 1 infection
    110548438 (Il12b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110548438 (Il12b)
   05145 Toxoplasmosis
    110548438 (Il12b)
   05140 Leishmaniasis
    110548438 (Il12b)
   05142 Chagas disease
    110548438 (Il12b)
   05143 African trypanosomiasis
    110548438 (Il12b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110548438 (Il12b)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110548438 (Il12b)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interleukins
   110548438 (Il12b)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Heparin
  Cytokines
   110548438 (Il12b)
SSDB
Motif
Pfam: IL12p40_C Ig_5 Ig_4 fn3 Ig_3 Ig_2 AlcCBM31
Other DBs
NCBI-GeneID: 110548438
NCBI-ProteinID: XP_021492361
LinkDB
Position
Unknown
AA seq 344 aa
MCHQKLTISWFAVVLLASPLMAIWELEKNVYVVEMDWRSGANESVVLTCDTSEEGDITWT
KDQTTKVEQSGKTVTIEVKDFNEAGQYTCHKGDQTLSHFRLLLHKKKNGYWSNEILKQDK
NSENQTFLKCEAANYSGRFTCSWLVERTDLKFSIKNSSSSPDSRAVTCGAVSLTAEKVKG
DEKDGKLKQYSVTCQEDITCPTAEETVPIGLVLEAQEQNKYENYSTSFFIRDIITPDPPK
NLKVKPLKNDKVEVSWEYPDSWSTPHSYFALKFCVWTESNKENKMRNTNSNKENKMRNAC
IQNGTWLVDTTSTKVRCKDGRVCVEAQDRYYNSLYSKHACVPCK
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtgtcatcagaagctaaccatctcctggtttgctgtggttctgctggcatctccactt
atggccatatgggagctggagaaaaatgtttatgttgtagagatggactggaggagcggt
gcgaatgaaagcgtggtcctcacctgtgacacttctgaagagggtgatatcacctggacc
aaagaccagacgaccaaagtagagcaatctggaaaaaccgtgaccatcgaagtcaaagac
ttcaatgaagctggtcaatatacctgccacaaaggagaccagaccctcagccacttccgt
ctgctgctccacaagaagaaaaacggatattggtccaatgagatcttaaagcaggataaa
aattccgaaaatcagactttcctgaaatgtgaggcagcaaattactccgggcgtttcacg
tgctcttggctggtggaaaggactgacttgaagttcagcatcaagaacagcagtagttcc
cctgactcccgagcagtgacgtgtggagctgtgtctctgaccgcagagaaagtcaaaggg
gatgaaaaggatggtaagcttaagcagtactcagtgacgtgccaggaggacatcacctgc
ccaactgcagaggagactgtgcccattggcctggtgctggaggcacaggagcagaataaa
tatgagaactacagcaccagcttcttcatcagagacatcatcacaccggaccctcccaag
aacctgaaggtgaaacctttgaagaacgataaggtggaggtcagctgggagtaccctgac
tcctggagcaccccccattcctacttcgccctcaagttctgtgtttggaccgagagcaat
aaagaaaataagatgaggaacacaaatagcaataaagaaaataagatgaggaacgcatgt
atacagaatggcacatggctagtagacacgacctccaccaaagtccggtgcaaagatgga
agagtctgcgtggaggctcaggatcgctactacaattctttgtatagcaaacatgcgtgc
gtgccctgcaaatag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110557307
Entry
110557307         CDS       T05884                                 

Gene name
Il12a
Definition
(RefSeq) interleukin-12 subunit alpha
  KO
K05406  interleukin 12A
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04620  Toll-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04940  Type I diabetes mellitus
mun05133  Pertussis
mun05134  Legionellosis
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05143  African trypanosomiasis
mun05144  Malaria
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05321  Inflammatory bowel disease
mun05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110557307 (Il12a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110557307 (Il12a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110557307 (Il12a)
   04622 RIG-I-like receptor signaling pathway
    110557307 (Il12a)
   04625 C-type lectin receptor signaling pathway
    110557307 (Il12a)
   04658 Th1 and Th2 cell differentiation
    110557307 (Il12a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110557307 (Il12a)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110557307 (Il12a)
   05330 Allograft rejection
    110557307 (Il12a)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110557307 (Il12a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110557307 (Il12a)
   05134 Legionellosis
    110557307 (Il12a)
   05152 Tuberculosis
    110557307 (Il12a)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110557307 (Il12a)
   05164 Influenza A
    110557307 (Il12a)
   05162 Measles
    110557307 (Il12a)
   05168 Herpes simplex virus 1 infection
    110557307 (Il12a)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110557307 (Il12a)
   05144 Malaria
    110557307 (Il12a)
   05145 Toxoplasmosis
    110557307 (Il12a)
   05140 Leishmaniasis
    110557307 (Il12a)
   05142 Chagas disease
    110557307 (Il12a)
   05143 African trypanosomiasis
    110557307 (Il12a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110557307 (Il12a)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110557307 (Il12a)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interleukins
   110557307 (Il12a)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Heparin
  Cytokines
   110557307 (Il12a)
SSDB
Motif
Pfam: IL12 RHH_1
Other DBs
NCBI-GeneID: 110557307
NCBI-ProteinID: XP_021507255
LinkDB
Position
Unknown
AA seq 210 aa
MRQSRRLFFLVTLVLIHLSLARAKPVSGPARCLNSSQTLLRTTDNALKTARQKLTNYCGA
EDFDREDITKDKTSTLKACLPLELVKNESCLAGETSSMIRGSCLLPQKTSSMMTLCLSSI
YEDLKIYQTEFQAIDAELRRQNQITLDKDMLAAIDELMQALNHNGQTVPRKPYLAERDPI
KLEMHLCIQLHAFSIRVTTINKVMSYLNSS
NT seq 633 nt   +upstreamnt  +downstreamnt
atgcgtcagtcacgccgcctcttctttttggtcacccttgtcctaatccacctcagtttg
gccagagccaagccggtctccggacccgcccggtgtcttaacagctcccaaaccctgctc
aggactacggacaacgcgctgaagacggccagacaaaagctaactaactactgtggtgct
gaagacttcgatcgcgaagacatcacaaaagacaaaaccagcacactgaaggcctgttta
ccactggaactggtcaagaatgagagttgcctggctggagagacttcttccatgatcaga
gggagctgcctgcttccccaaaagacttcttccatgatgaccctgtgccttagtagcatc
tatgaggacttgaagatttaccagacagagttccaggccatagacgcagagcttcggcgt
cagaatcagatcactctggacaaggacatgttggcagccattgatgagctgatgcaggct
ctgaatcataatgggcagactgtgccccggaaaccttacctggcagaaagagaccctatc
aaattggaaatgcatctctgcattcaactccatgctttcagcatccgagtcacgaccatc
aacaaagtgatgagctatctgaactcctcctga

DBGET integrated database retrieval system