KEGG   Meriones unguiculatus (Mongolian gerbil): 110548604
Entry
110548604         CDS       T05884                                 

Gene name
Tnfrsf1a
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04060  Cytokine-cytokine receptor interaction
mun04061  Viral protein interaction with cytokine and cytokine receptor
mun04064  NF-kappa B signaling pathway
mun04071  Sphingolipid signaling pathway
mun04150  mTOR signaling pathway
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04668  TNF signaling pathway
mun04920  Adipocytokine signaling pathway
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun05010  Alzheimer disease
mun05014  Amyotrophic lateral sclerosis
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110548604 (Tnfrsf1a)
   04064 NF-kappa B signaling pathway
    110548604 (Tnfrsf1a)
   04668 TNF signaling pathway
    110548604 (Tnfrsf1a)
   04071 Sphingolipid signaling pathway
    110548604 (Tnfrsf1a)
   04150 mTOR signaling pathway
    110548604 (Tnfrsf1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110548604 (Tnfrsf1a)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110548604 (Tnfrsf1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110548604 (Tnfrsf1a)
   04215 Apoptosis - multiple species
    110548604 (Tnfrsf1a)
   04217 Necroptosis
    110548604 (Tnfrsf1a)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110548604 (Tnfrsf1a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110548604 (Tnfrsf1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110548604 (Tnfrsf1a)
   05014 Amyotrophic lateral sclerosis
    110548604 (Tnfrsf1a)
   05022 Pathways of neurodegeneration - multiple diseases
    110548604 (Tnfrsf1a)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110548604 (Tnfrsf1a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110548604 (Tnfrsf1a)
   04931 Insulin resistance
    110548604 (Tnfrsf1a)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110548604 (Tnfrsf1a)
   05152 Tuberculosis
    110548604 (Tnfrsf1a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110548604 (Tnfrsf1a)
   05170 Human immunodeficiency virus 1 infection
    110548604 (Tnfrsf1a)
   05160 Hepatitis C
    110548604 (Tnfrsf1a)
   05171 Coronavirus disease - COVID-19
    110548604 (Tnfrsf1a)
   05164 Influenza A
    110548604 (Tnfrsf1a)
   05168 Herpes simplex virus 1 infection
    110548604 (Tnfrsf1a)
   05163 Human cytomegalovirus infection
    110548604 (Tnfrsf1a)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110548604 (Tnfrsf1a)
   05165 Human papillomavirus infection
    110548604 (Tnfrsf1a)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110548604 (Tnfrsf1a)
   05142 Chagas disease
    110548604 (Tnfrsf1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110548604 (Tnfrsf1a)
   04090 CD molecules [BR:mun04090]
    110548604 (Tnfrsf1a)
Cytokine receptors [BR:mun04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   110548604 (Tnfrsf1a)
CD molecules [BR:mun04090]
 Proteins
  110548604 (Tnfrsf1a)
SSDB
Motif
Pfam: TNFR_c6 Death ABATE DUF4880
Other DBs
NCBI-GeneID: 110548604
NCBI-ProteinID: XP_021492703
LinkDB
Position
Unknown
AA seq 462 aa
MGLPTVPGLLLSLVLLALLVGIHPLGVTGLVPSLGDREKRDSSCPQGKYAHPLNNSVCCT
KCHKGTYLVSDCPSPGRETVCKDCDKGTFTASQNHLRQCLSCKTCREEMSQVEISPCRAD
RDTVCGCKENQYRDYLGEKLFRCRNCSPCFNGTVTIPCKENQDTVCDCHAGFFLRGNECV
SCSHCKKNEECMKLCLPLSANVTNPQDSGTAVLLPLVIFLGLCLSFFIFINLICRYRRWK
PNVYSIICGNSAPVKEVEVEGIVTKPLTPAPTSALSPTPGINSVLAGSPTPGFGPISSTP
SPTFSPSNWPNYTTVMTPIREVVPTQVADPLLYASTSTTPVPVPTPVPKWEDSVHPRHPD
IADPATLYAVVDGVPPTRWREFMRLLGLSEHEIERLELQNVRCLREAHYSMLETWRQRRP
RHEATLDEVGRVLCHMDLPGCLENILEKLGSPASSSAPRPLR
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgggtctccccaccgtgcctggcctgctgctgtcactggtgctcctggccctgttggtg
gggatccaccccttgggggtcactggactggtcccttcccttggggaccgggagaagagg
gatagttcgtgtccccagggaaagtatgcccaccctctgaataattccgtctgctgtacc
aagtgccacaaaggaacctacttggtgagtgactgtccaagcccagggcgggaaacagtg
tgcaaggattgtgataaaggcacttttacggcttcccagaaccacctcagacagtgcctc
agctgcaagacatgtcgggaagaaatgtcccaggtggagatttctccctgcagagcggac
agggacactgtgtgtggctgtaaggagaaccagtaccgggactacttgggtgaaaagctc
ttccggtgcaggaactgcagcccctgcttcaacggcactgtgactatcccctgtaaggag
aatcaggacaccgtgtgcgactgccacgcgggattcttcctaagaggaaatgagtgcgtc
tcctgcagccattgcaagaaaaatgaagagtgtatgaagttgtgcctacctctgtctgca
aatgtcacaaacccccaggactcaggtaccgcagtgctgttgcctctggttatcttcctt
ggactttgcctttcattctttatcttcatcaacctaatatgccgatatcgccggtggaag
cccaatgtctactccatcatttgtgggaattcagctcctgtcaaagaggtggaggttgaa
ggaattgttactaagcccctaactccagcccctacctcagccttgagccccacccctggc
atcaactccgttctggccggcagccccaccccaggcttcggtcctatctccagtaccccc
agtcccaccttcagccctagtaactggcccaactacaccacggtcatgacacctataagg
gaggtggtcccaacccaggttgctgaccctctcctctatgcatccacatccaccaccccg
gttccggtccccacccctgttccgaaatgggaagactccgtccacccgcgtcatcctgac
attgcagaccctgctacactgtacgcggtggtggacggcgtgcctccgacccgctggagg
gagtttatgcggctcctggggctgagcgagcacgagatcgagaggctggagctgcagaac
gtgcgctgcctgcgcgaggctcactacagcatgctggaaacctggcgacaacgcaggccg
cgccacgaggccacgctggacgaagtgggacgcgtgctttgccacatggacctgccgggc
tgcctggagaacatcctggaaaagctgggaagccccgcctcctcgtccgcgccccgcccc
ctgcgatga

DBGET integrated database retrieval system