KEGG   Meriones unguiculatus (Mongolian gerbil): 110548643
Entry
110548643         CDS       T05884                                 

Gene name
Ifih1
Definition
(RefSeq) interferon-induced helicase C domain-containing protein 1
  KO
K12647  interferon-induced helicase C domain-containing protein 1 [EC:3.6.4.13]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04622  RIG-I-like receptor signaling pathway
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    110548643 (Ifih1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    110548643 (Ifih1)
   05171 Coronavirus disease - COVID-19
    110548643 (Ifih1)
   05164 Influenza A
    110548643 (Ifih1)
   05162 Measles
    110548643 (Ifih1)
   05168 Herpes simplex virus 1 infection
    110548643 (Ifih1)
Enzymes [BR:mun01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110548643 (Ifih1)
Pattern recognition receptors [BR:mun04054]
 Cytoplasmic pattern recognition receptors
  RIG-I-like receptors
   110548643 (Ifih1)
SSDB
Motif
Pfam: CARD_2 RIG-I_C RIG-I_C-RD Helicase_C ResIII DEAD CARD SWI2_SNF2 AAA_22 AAA_19 DUF3638
Other DBs
NCBI-GeneID: 110548643
NCBI-ProteinID: XP_021492759
LinkDB
Position
Unknown
AA seq 1021 aa
MSSSAEDRFRYHISCFRPRLKSYIQVEPVLDYLVFLPAETKEQILKRVTTCGNTSAAGLL
LSTLERGAWPAGWGQMFVEALQRSGNPLAARYVQPTLTDLPSPSSETVHDECLHLLNLLQ
PTLVDRLLFNDVLDPCVEKGLLTAEDRNRISAAGNSGNESGVRELLKRIVQKENWFSTFL
EVLRQTGNDALAQELTGVDCPESTAELENSSHEDGPEANEPLVSAIDDSRLETEAWNTED
TSPEVSFTASSVTTESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGRDSDERMGTQRTSP
EPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYITKDHLDKKKQASEPGKVIIL
VNKVMLAEQLFRKEFNPFLKKWYRIIGLSGDTQLKISFPEVVKSYDVIISTAQILENSLF
NRESGEDDGVQLSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLKNNTLKKQNKPVIPLP
QILGLTASPGVGGAKKQSEAEKHILNICANLDAFTIKTVNENLGQLKHQIKEPCKKFVIA
DDTRENPFKEKLLEIMASIQTYCQMSPMSEFGTQHYEQWAIQMEKKAAKAGNRKHRACAE
HLRKYNEALQINDTIRMIDAYSHLESFYADEKEKKFAVLEDSDESEEDASSHDDELKDNV
KKSLKMDETDEFLMDLFFDNRKMLKKLAENPEYENEKLTKLRNTILEQFTRTEESSRGII
FTKTRQSTYALSQWIMENEKFAEVGIKAHHLIGAGHSSEVKPMTQNEQKEVISKFRTGEI
NLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVTSSGSGVTER
EIVNDFREKMMYKAINRVQNMNPEEYAHEILKLQVQSILEKKMKVKRSIAKHYNNPSLIT
LLCKNCSMLVCSGENIYVIEKMHHVNMTPEFKRLYIVRENKALQKKFADYQANGEIICKC
GQAWGTMMVHKGLDLPCLKIRNFVVDFKNNSSKKQYKRWVELPVRFPDLDCSEHCLSSDE
D
NT seq 3066 nt   +upstreamnt  +downstreamnt
atgtcgagctccgcagaggacaggttccgctatcacatctcctgcttcaggcccaggttg
aagagctacattcaagtggagccggtgctggactacctcgtctttctgcccgcagaaacc
aaagagcagatcctcaaacgggtcaccacctgtgggaacaccagcgccgcgggactgctg
ctgagcaccttggagaggggggcgtggccggccgggtgggggcagatgtttgtggaggcc
ctgcagcgcagtggcaaccccctagccgcgcgctacgtccaacccacactcaccgacctg
ccctctccctcctccgagaccgtccacgatgagtgtctccacctgctgaacctccttcag
cccaccttggtggacaggcttctgtttaacgatgtcttggatccctgcgtggagaagggg
ctgttgacagcggaggacaggaatcggatctctgctgcaggaaacagtggaaatgagtca
ggtgtgagagaactgctgaaaaggattgtgcagaaagaaaactggttttctacttttctg
gaagttcttcgtcaaactggaaatgatgcactagcccaagagctaacaggtgttgactgc
ccagaaagcactgcagagctggagaattcatctcacgaagatgggcctgaggctaatgag
ccccttgtgtctgctatagatgattcaaggctggagacagaggcctggaacacagaggat
acctcaccagaggtctcctttacagcgtcttctgtgaccacagaatcagacacaagtttg
gcagaaggaagtgtcagctgcttagatgaaagtcttggacataacagcaacatgggcagt
gattcaggcaccatgggaagggattcagatgaaaggatggggacacagagaacatctcct
gagccagaactgcagctcaggccttatcaaatggaagtggcccaaccagcattggagggg
aagaatattatcatctgtctccccacggggagtgggaaaaccagagtggctgtttacatc
accaaagatcacttagacaagaagaagcaggcatctgaacccgggaaggttatcatcctt
gtcaataaggtgatgttagctgaacaactttttcgcaaagagttcaacccatttttaaag
aaatggtatcgcattattgggttaagtggtgatacccagctgaaaatatcgtttccagaa
gttgtcaaatcttacgatgttattatcagcacagctcagatccttgaaaattccctcttt
aatcgggagagcggagaagatgatggcgtacagctgtcagatttttccctcattatcatt
gacgagtgtcatcacaccaacaaggaggcagtctataacaacatcatgagacgatatttg
aagcagaagttgaagaataataccctcaagaaacaaaacaagccagtaattcccctgccc
cagatactaggactgacagcttcgcctggtgttggaggagccaaaaagcaatctgaggcc
gaaaagcatatcttaaatatatgtgccaatcttgatgcattcaccattaaaacagtgaat
gagaatcttggtcaactcaagcatcaaataaaggaaccctgcaagaagtttgtgattgct
gatgacaccagagaaaatccatttaaagaaaaacttctagaaattatggcaagcattcaa
acttactgccaaatgagtccaatgtccgaatttggaacccagcattatgagcaatgggcc
attcaaatggaaaaaaaagctgcgaaggccgggaatcgcaaacaccgtgcctgtgcggaa
catttgaggaaatacaacgaagccctgcagatcaacgacaccatccggatgattgacgcg
tacagccacctggaaagcttctacgctgatgagaaagaaaagaagtttgccgtcttagag
gacagtgacgagagcgaagaagatgctagcagtcacgatgatgaacttaaggacaatgta
aagaaatctttgaaaatggacgaaacagatgaatttctcatggatttattctttgataac
aggaaaatgttgaaaaaactagccgaaaacccagaatatgaaaatgaaaaactcactaaa
ttaagaaacaccatattggaacaattcacaaggactgaggaatcgtctcgaggaattatt
ttcacgaaaacccggcagagcacctacgcactctcccagtggattatggaaaatgaaaag
tttgcagaagttggcatcaaagcacaccacctgattggagcaggacacagcagtgaagtc
aagcccatgacacagaacgaacaaaaagaagtcattagtaaatttcgcacaggagaaata
aatctgcttatagctactacagtggcagaggaaggcctggatatcaaagaatgcaatatc
gttatccgttatggcctcgtcacgaatgagatagccatggtccaggcccgtggtcgagcc
agagctgatgaaagtacctacgtcctggttaccagtagtggctcgggcgttactgaacgt
gagattgtgaacgatttccgagagaagatgatgtacaaagctataaatcgtgttcagaat
atgaacccagaggagtatgcacatgagattttgaaattacaggtacaaagtatcttggaa
aagaaaatgaaggtcaaaagaagcattgcaaagcattacaacaatccgtcgttaataact
cttctctgcaaaaactgtagtatgctggtgtgctcaggagaaaacatctatgtaattgag
aagatgcatcatgtcaatatgacaccggaattcaagagactctacattgtaagagaaaac
aaggcactacagaagaaatttgctgattatcaagcaaatggagagattatctgcaaatgt
ggccaagcgtggggaacaatgatggtgcacaaaggtttagatttgccttgtcttaaaata
aggaattttgttgtagatttcaaaaataattcatcaaaaaagcagtataagaggtgggtg
gaactgccagtccggtttcctgatctagattgctcagaacattgcctgtccagtgatgaa
gactag

DBGET integrated database retrieval system