KEGG   Meriones unguiculatus (Mongolian gerbil): 110548759
Entry
110548759         CDS       T05884                                 

Gene name
Il4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04630  JAK-STAT signaling pathway
mun04640  Hematopoietic cell lineage
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04672  Intestinal immune network for IgA production
mun05140  Leishmaniasis
mun05200  Pathways in cancer
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease
mun05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110548759 (Il4)
   04151 PI3K-Akt signaling pathway
    110548759 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110548759 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110548759 (Il4)
   04660 T cell receptor signaling pathway
    110548759 (Il4)
   04658 Th1 and Th2 cell differentiation
    110548759 (Il4)
   04659 Th17 cell differentiation
    110548759 (Il4)
   04657 IL-17 signaling pathway
    110548759 (Il4)
   04664 Fc epsilon RI signaling pathway
    110548759 (Il4)
   04672 Intestinal immune network for IgA production
    110548759 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110548759 (Il4)
  09163 Immune disease
   05310 Asthma
    110548759 (Il4)
   05320 Autoimmune thyroid disease
    110548759 (Il4)
   05321 Inflammatory bowel disease
    110548759 (Il4)
   05330 Allograft rejection
    110548759 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110548759 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110548759 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110548759 (Il4)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interleukins
   110548759 (Il4)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Haparin
  Cytokines
   110548759 (Il4)
SSDB
Motif
Pfam: IL4 DUF3016
Other DBs
NCBI-GeneID: 110548759
NCBI-ProteinID: XP_021492996
LinkDB
Position
Unknown
AA seq 143 aa
MGLSPQLAAVLLCLLVCTGNYARRQDREAGLREIIHNLDQVLKKETPCTEMFVPDVLIAT
KNTTEKGLLCRATRVLRKFYFPREVTPCLKNNSGVLSILRKLCRSISTLHPQESCSVSTP
TLTTLNDFLGRLRGIMQMKNWQG
NT seq 432 nt   +upstreamnt  +downstreamnt
atgggtctcagcccccagctagctgctgtcctgctctgccttctagtgtgtaccgggaac
tatgctcgcagacaggacagagaggcaggcttgagagagatcatccacaatttggaccag
gtcttaaagaaagagacaccatgcacggagatgtttgtgccagatgtcctcatagcaacg
aagaacaccacagagaagggactcctctgcagagctaccagggtgctccgcaaattttac
ttcccacgagaggtgactccatgcttgaagaacaactccggggtcctcagcatcttgaga
aaactctgtcggagcatcagtaccctgcatccacaggaaagctgtagtgtgagcacgccc
acactcacgacgctgaatgacttcctgggacgcctaagagggatcatgcagatgaaaaac
tggcagggttga

DBGET integrated database retrieval system