KEGG   Meriones unguiculatus (Mongolian gerbil): 110548765
Entry
110548765         CDS       T05884                                 

Gene name
Kif3a
Definition
(RefSeq) kinesin-like protein KIF3A isoform X1
  KO
K10394  kinesin family member 3A
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110548765 (Kif3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mun04812]
    110548765 (Kif3a)
Cytoskeleton proteins [BR:mun04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     110548765 (Kif3a)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 110548765
NCBI-ProteinID: XP_021493002
LinkDB
Position
Unknown
AA seq 702 aa
MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYRQAVSVDEMRGTITVHKTDSSNEPPKT
FTFDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRSVPGLR
GVIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVY
IKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFTITIECSEKGVDGNMH
VRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS
KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALL
RQFQKEIEELKKKLEEGEEVSGSDISGSEEDDNEEGELGEDGEKRKKRRDQAGKKKVSPD
KMVEMQAKIDEERKALETKLDMEEEERNKARAELERREKDLLKAQQEHQSLLEKLSALEK
KVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRKELEEKEQERLDIEEKYTSLQE
EAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIP
QDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKERDPFEVDLSHVYLAYTE
ESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgccgatcaataaatctgagaagcccgaaagctgcgataatgtgaaggttgttgtgagg
tgccggcccctcaatgaaagagagaaatcaatgtgctatagacaggccgtcagcgtggat
gagatgaggggtaccatcactgtccataagaccgattcttccaacgaacctccgaagaca
tttacttttgatactgtttttggaccagaaagtaaacagcttgatgtatataacttaact
gcaagacctattattgattctgttctggaaggctacaatgggaccatttttgcatatgga
cagacggggacaggcaagactttcaccatggaaggtgttcgctcagtgccggggctcaga
ggggtcatccccaactcatttgcccacatatttggtcacatcgcgaaagcagagggtgac
acaaggtttttggttcgagtgtcatacttagagatatataatgaagaagttcgggacctt
ttaggcaaggatcagactcagaggctggaggttaaagaaaggcctgatgtgggagtgtat
atcaaagatctatcagcttatgtggtcaataatgctgacgatatggatagaatcatgact
ctgggccacaaaaaccgttctgttggtgcgaccaatatgaatgagcacagttcccgatcc
catgccatctttacaatcactatagaatgcagtgagaaaggcgttgatggaaatatgcat
gtcaggatggggaaactccacctcgtggatcttgctgggtcagaaagacaggcaaaaact
ggagccacgggacagcgcctcaaggaagcgacaaaaatcaacctttcgctctccaccctg
ggcaatgtcatttctgccttggtggatggaaaaagcactcatgtgccttatcggaactct
aaactgacgcgtcttctgcaggattccttaggagggaactcaaaaaccatgatgtgtgca
aatattgggccagcagattataattatgatgaaaccatcagtaccttgcggtacgccaac
cgcgccaaaaacattaaaaacaaagccagaatcaatgaagacccaaaggatgctctgctt
cgccagtttcagaaagaaatagaagagctgaagaaaaagcttgaggaaggggaagaagta
tcaggctctgacatcagtgggtcagaggaggatgacaatgaggagggggaacttggagaa
gatggtgaaaaaaggaaaaagagaagggaccaagcaggtaaaaagaaagtttccccagat
aagatggtggaaatgcaagcgaaaattgatgaggagagaaaagcactggaaacaaaactt
gacatggaagaagaagaaagaaacaaggctagagctgaactcgagagacgggagaaagac
cttctgaaagcccaacaagagcatcagtctttgctagaaaaactgtctgctttggagaag
aaggtaattgtcggtggtgtggacttgctggccaaagctgaagagcaagagaagcttctt
gaggagtccaatatggaactggaagagaggaggaaaagagctgagcaacttcggaaagaa
ctggaggaaaaagagcaagaacgcttggacattgaggagaaatacaccagtctgcaagag
gaggcgcaggggaagaccaagaagttgaagaaagtctggaccatgttaatggctgcaaag
tcagagatggctgatctccagcaggagcatcagagggagattgaaggcctcctggagaac
attcggcagctcagccgtgagcttcggcttcagatgctcattatcgataacttcatacct
caggattaccaggaaatgattgaaaactacgtgcattggaatgaagacattggagagtgg
cagctgaaatgtgtggcctacacgggaaataacatgaggaaacaaactccagtgcccgac
aagaaggagagagatccctttgaggtagacctttcccacgtgtacctcgcctatacagag
gagagtctgcgtcagtctctgatgaagttagagagaccacggacttccaagggaaaagca
aggccaaagacagggcgaagaaagcgttctgcaaaacctgagaccgtaatagattcttta
cttcagtaa

DBGET integrated database retrieval system