KEGG   Meriones unguiculatus (Mongolian gerbil): 110548802
Entry
110548802         CDS       T05884                                 

Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun01100  Metabolic pathways
Module
mun_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110548802
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     110548802
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase ADH_zinc_N Shikimate_DH RmlD_sub_bind THF_DHG_CYH_C NAD_binding_7 DUF1776 Sacchrp_dh_NADP
Other DBs
NCBI-GeneID: 110548802
NCBI-ProteinID: XP_021493057
LinkDB
Position
Unknown
AA seq 244 aa
MDLGLAGRRALVTGAGKGIGRSTVLALRAAGAHVVAVSRTQEDLDNLVRECPGVEPVCVD
LGDWEATEKALSSVGPVDLLVNNAAVALLQPFLEVTKEACDQSFSVNLRAVIQVSQIVAR
GMIARGVPGAIVNISSQASQRALTNHSVYCSTKGALDMLTKMMALELGPHKIRVNAVNPT
VVMTSMGRINWSDPQKAKAMLDRIPLGKFAEVENVVDAILFLLSDRSGMTSGSTLPVDGG
FLAT
NT seq 735 nt   +upstreamnt  +downstreamnt
atggacctggggcttgcaggtcggcgggcgctggtcaccggcgcgggcaaaggcatcggg
cgcagcaccgtgctggcgctgagggcggccggggcacacgtcgtggccgtgagccggacc
caagaggaccttgacaacctggtccgcgagtgtcctggcgtggagcctgtgtgtgtggac
ctgggagactgggaggccacggaaaaggccctgagctctgtgggaccagtggacctgctg
gtgaacaatgctgccgtggctctgttgcagcccttcctggaagtcaccaaggaggcctgt
gaccagtccttcagtgtgaatcttcgggctgtcatccaggtgtcccagatcgtggccagg
ggcatgatcgctcggggagtcccaggggccattgtgaacatctccagccaggcctcccag
cgtgcactgaccaaccatagtgtctactgttccaccaagggcgctctggacatgctgacc
aagatgatggctctagagcttgggccccacaagatccgtgtgaacgcagtcaaccccaca
gtagtgatgacctcgatgggccggatcaactggagtgacccccaaaaggccaaggctatg
ctggatcgcatccccctcggcaagtttgctgaggtggagaacgtggtggacgccatcctc
ttcctgctgagcgacaggagcggaatgacctctggctccactttgccggtggacgggggc
ttcctggctacctga

DBGET integrated database retrieval system