KEGG   Meriones unguiculatus (Mongolian gerbil): 110549164
Entry
110549164         CDS       T05884                                 

Gene name
Lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04015  Rap1 signaling pathway
mun04072  Phospholipase D signaling pathway
mun04080  Neuroactive ligand-receptor interaction
mun04151  PI3K-Akt signaling pathway
mun04810  Regulation of actin cytoskeleton
mun05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110549164 (Lpar2)
   04072 Phospholipase D signaling pathway
    110549164 (Lpar2)
   04151 PI3K-Akt signaling pathway
    110549164 (Lpar2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110549164 (Lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110549164 (Lpar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110549164 (Lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mun04030]
    110549164 (Lpar2)
G protein-coupled receptors [BR:mun04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    110549164 (Lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Rax2
Other DBs
NCBI-GeneID: 110549164
NCBI-ProteinID: XP_021493722
LinkDB
Position
Unknown
AA seq 348 aa
MGQCYYNETISFFYNNSGKELSLHWRPKDVVVVALGLAVSALVLLTNLLVIAAIASNRRF
HQPIYYLLGNLAAADLFAGMAYLFLMFHTGPRTARLSIKGWFLRQGLLDTSLTASVATLL
AIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWVAALGLGLLPAHFWHCLCDLDSCSQMVP
LFSRTYLAVWALSRLLVFLLMVAVYIRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTV
VIILGAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMR
RTFRRLLCCLCLRCSDHKSAPYSSSARTGASTRIMLPENGHPLMDSTL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgggccagtgctactacaatgagaccatcagctttttctacaataacagtggcaaggaa
ctcagccttcactggcgccccaaagatgtcgtcgtggtggcgctggggctggcagtcagt
gcgctcgtgttgctgaccaacctgctggttatcgcagccatcgcctccaaccgtcgcttc
caccagcccatctactacctgcttggcaacttggctgccgctgacctcttcgctggcatg
gcctacctcttcctcatgttccacactggtccacgcactgccagactctccatcaaaggc
tggttccttcgacagggcctgctggacaccagcctgacggcgtccgtggccacactgctg
gccatagctgtggagcggcaccgtagcgttatggctgtgcaactacacagccgcctgccc
cgggggcgtgtggtcacactcattgtgggtgtgtgggtggctgccctgggcctggggttg
ctgcctgcacacttctggcactgcctctgtgacttggacagttgctcacaaatggtcccc
ctcttcagccgcacctacctggctgtgtgggccctgtccaggctgcttgttttcctgctc
atggtagccgtctacattcgaatcttcttctatgtgcgtagacgggtggaacgcatggcg
gagcatgtaagctgccatccccgctaccgagagacaacgctcagcctggtcaagacggtt
gtcatcatcctgggggcgttcgtggtgtgctggacgcctggccaggtggtgctgctcctg
gacggtctggactgtaaatcctgcaacgttctggctgtggagaagtacttcctgctcctg
gctgaggccaactcactggtcaacgccgtggtgtactcctgccgggatgctgagatgcgc
cggaccttccgccgccttctctgctgtctgtgtctccgctgctccgaccacaagtctgcc
ccttactcatcttctgcccggacgggtgccagcacccgaatcatgcttcctgagaatggc
cacccactgatggactccactctttag

DBGET integrated database retrieval system