KEGG   Meriones unguiculatus (Mongolian gerbil): 110549244
Entry
110549244         CDS       T05884                                 

Gene name
Tgfb2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04060  Cytokine-cytokine receptor interaction
mun04068  FoxO signaling pathway
mun04110  Cell cycle
mun04218  Cellular senescence
mun04350  TGF-beta signaling pathway
mun04380  Osteoclast differentiation
mun04390  Hippo signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05144  Malaria
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05220  Chronic myeloid leukemia
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05321  Inflammatory bowel disease
mun05323  Rheumatoid arthritis
mun05410  Hypertrophic cardiomyopathy
mun05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110549244 (Tgfb2)
   04350 TGF-beta signaling pathway
    110549244 (Tgfb2)
   04390 Hippo signaling pathway
    110549244 (Tgfb2)
   04068 FoxO signaling pathway
    110549244 (Tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110549244 (Tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110549244 (Tgfb2)
   04218 Cellular senescence
    110549244 (Tgfb2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110549244 (Tgfb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110549244 (Tgfb2)
   05206 MicroRNAs in cancer
    110549244 (Tgfb2)
   05205 Proteoglycans in cancer
    110549244 (Tgfb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110549244 (Tgfb2)
   05212 Pancreatic cancer
    110549244 (Tgfb2)
   05225 Hepatocellular carcinoma
    110549244 (Tgfb2)
   05226 Gastric cancer
    110549244 (Tgfb2)
   05220 Chronic myeloid leukemia
    110549244 (Tgfb2)
   05211 Renal cell carcinoma
    110549244 (Tgfb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110549244 (Tgfb2)
   05321 Inflammatory bowel disease
    110549244 (Tgfb2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110549244 (Tgfb2)
   05414 Dilated cardiomyopathy
    110549244 (Tgfb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110549244 (Tgfb2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110549244 (Tgfb2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110549244 (Tgfb2)
   05161 Hepatitis B
    110549244 (Tgfb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110549244 (Tgfb2)
   05144 Malaria
    110549244 (Tgfb2)
   05145 Toxoplasmosis
    110549244 (Tgfb2)
   05140 Leishmaniasis
    110549244 (Tgfb2)
   05142 Chagas disease
    110549244 (Tgfb2)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110549244 (Tgfb2)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110549244 (Tgfb2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110549244
NCBI-ProteinID: XP_021493906
LinkDB
Position
Unknown
AA seq 414 aa
MHYCVLRTFLLLHLVPVALGLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEHYPEP
GKVPTEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHFPSENAIPP
TFYRPYFRIVRFDVSPMEKNASNLVKAEFRVFRLQNPKARVAEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGPSTYAGGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLEPQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
TRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcactactgcgtgctgagaacctttttgctcctgcatctggtcccggtggcgctcggt
ctgtctacctgcagcaccctggacatggaccagtttatgcgcaagaggatcgaggccatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccggagcactaccctgagccg
ggcaaggtccccacggaggtgatttccatctacaacagtaccagggacttactgcaggag
aaggcaagccggagggcagccgcctgcgagcgcgagcggagcgacgaggagtactatgcc
aaggaggtttataaaatcgacatgccgtcccacttcccctccgaaaatgccatcccgccc
actttctacagaccgtacttcagaatcgtccgcttcgatgtctccccgatggagaagaat
gcttctaatctggtgaaggcggagttcagagtgtttcgcttgcagaaccccaaagccaga
gtggctgaacaacggattgagctctaccagatcctcaagtccaaagacttaacatctccg
acccagcgctacatcgacagcaaggttgtgaagaccagagcggagggcgagtggctgtcc
ttcgatgtcactgacgcagtgcacgagtggcttcaccacagagacaggaacctgggattt
aaaataagtttacactgcccctgctgtactttcgtgccatcgaataattacatcatcccg
aataaaagcgaagagctagaggcgagatttgcaggtattgatggcccctccacatatgcc
ggtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttgttgccctcctacagactggagccacaacagtccaacaggcggaag
aagcgtgctttggatgccgcctattgctttagaaatgtgcaggataattgctgccttcgg
cctctttacattgatttcaagagggatcttggatggaaatggatccatgaaccgaaaggg
tacaatgctaacttctgtgctggggcgtgcccatatctttggagttcagacactcagcac
accagggtcctcagcttgtataacaccataaatccggaagcttctgcttccccttgctgc
gtgtcccaggatctagaaccgctgaccatcctctactacattggaaacacacccaagatc
gaacagctttccaacatgatcgtcaagtcctgtaaatgcagctaa

KEGG   Meriones unguiculatus (Mongolian gerbil): 110558214
Entry
110558214         CDS       T05884                                 

Gene name
Tgfb3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04060  Cytokine-cytokine receptor interaction
mun04068  FoxO signaling pathway
mun04110  Cell cycle
mun04218  Cellular senescence
mun04350  TGF-beta signaling pathway
mun04390  Hippo signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05144  Malaria
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05220  Chronic myeloid leukemia
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05321  Inflammatory bowel disease
mun05323  Rheumatoid arthritis
mun05410  Hypertrophic cardiomyopathy
mun05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110558214 (Tgfb3)
   04350 TGF-beta signaling pathway
    110558214 (Tgfb3)
   04390 Hippo signaling pathway
    110558214 (Tgfb3)
   04068 FoxO signaling pathway
    110558214 (Tgfb3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110558214 (Tgfb3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110558214 (Tgfb3)
   04218 Cellular senescence
    110558214 (Tgfb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110558214 (Tgfb3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110558214 (Tgfb3)
   05212 Pancreatic cancer
    110558214 (Tgfb3)
   05225 Hepatocellular carcinoma
    110558214 (Tgfb3)
   05226 Gastric cancer
    110558214 (Tgfb3)
   05220 Chronic myeloid leukemia
    110558214 (Tgfb3)
   05211 Renal cell carcinoma
    110558214 (Tgfb3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110558214 (Tgfb3)
   05321 Inflammatory bowel disease
    110558214 (Tgfb3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110558214 (Tgfb3)
   05414 Dilated cardiomyopathy
    110558214 (Tgfb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110558214 (Tgfb3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110558214 (Tgfb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110558214 (Tgfb3)
   05161 Hepatitis B
    110558214 (Tgfb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110558214 (Tgfb3)
   05144 Malaria
    110558214 (Tgfb3)
   05145 Toxoplasmosis
    110558214 (Tgfb3)
   05140 Leishmaniasis
    110558214 (Tgfb3)
   05142 Chagas disease
    110558214 (Tgfb3)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110558214 (Tgfb3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110558214
NCBI-ProteinID: XP_021508676
LinkDB
Position
Unknown
AA seq 410 aa
MHLQKALVVLALLNLATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSVM
THVPYQVLALYNSTRELLEEMHGEKEEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAV
CPKGITSKIFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRMEQRIELFQILRPDEHIAK
QRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENV
HEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLHSPGQGGQRKKRAL
DTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVL
GLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgcacttgcaaaaggctctggtggtcctggccctactgaacttggccacagtcagcctc
tctctgtccacttgcaccaccttggacttcggccacatcaagaagaaaagggtggaagcc
attaggggacagatcttgagcaagctcaggctcaccagcccccctgagccgtcggtgatg
acccacgtcccctatcaggtcctggcactttacaacagcacccgggagcttctggaagag
atgcacggggaaaaggaggaaggctgcactcaggaaaacactgagtcggagtactatgcc
aaagagatccataagttcgacatgatccagggactggccgagcacaatgagctggctgtc
tgccccaaagggattacctctaagatttttcgtttcaacgtgtcctcagtggagaaaaat
ggaaccaatctgttccgggcagagttccgggtcctgcgggtgcccaaccccagctccaag
cgcatggagcagagaattgagctcttccagattctgcgaccagatgagcacatcgccaag
cagcgctacattggcggcaagaatctgcccacaaggggcactgctgagtggctgtctttt
gatgtcactgacactgtgcgcgagtggctgttgcggagagagtccaacttgggcctggaa
atcagcattcactgtccatgccacacctttcagcccaatggagatatactggaaaatgtt
cacgaggtgatggagatcaaattcaaaggagtggacaatgaagatgaccatggccgcgga
gacctggggcgtctcaagaagcagaaggaccaccacaaccctcacctgatcctcatgatg
atccccccacaccgactccacagcccgggccagggcgggcagaggaagaagcgggcactg
gacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccccctctacatt
gacttccggcaggatctgggctggaaatgggtccacgaacctaagggttactatgccaac
ttctgctcgggcccctgcccgtacctccgcagcgcagacacaacccacagcacggtgctg
ggactgtacaacaccctgaacccggaggcctcggcctcaccatgctgcgtgccccaggac
ctggagcccctgaccatcctgtactacgtcggcaggacccccaaggtggagcagctgtct
aacatggtggtgaagtcgtgcaagtgcagctga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110561197
Entry
110561197         CDS       T05884                                 

Gene name
Tgfb1
Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04010  MAPK signaling pathway
mun04060  Cytokine-cytokine receptor interaction
mun04068  FoxO signaling pathway
mun04110  Cell cycle
mun04218  Cellular senescence
mun04350  TGF-beta signaling pathway
mun04380  Osteoclast differentiation
mun04390  Hippo signaling pathway
mun04659  Th17 cell differentiation
mun04672  Intestinal immune network for IgA production
mun04926  Relaxin signaling pathway
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05144  Malaria
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05205  Proteoglycans in cancer
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05220  Chronic myeloid leukemia
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05321  Inflammatory bowel disease
mun05323  Rheumatoid arthritis
mun05410  Hypertrophic cardiomyopathy
mun05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110561197 (Tgfb1)
   04350 TGF-beta signaling pathway
    110561197 (Tgfb1)
   04390 Hippo signaling pathway
    110561197 (Tgfb1)
   04068 FoxO signaling pathway
    110561197 (Tgfb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110561197 (Tgfb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110561197 (Tgfb1)
   04218 Cellular senescence
    110561197 (Tgfb1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110561197 (Tgfb1)
   04672 Intestinal immune network for IgA production
    110561197 (Tgfb1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110561197 (Tgfb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110561197 (Tgfb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110561197 (Tgfb1)
   05205 Proteoglycans in cancer
    110561197 (Tgfb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110561197 (Tgfb1)
   05212 Pancreatic cancer
    110561197 (Tgfb1)
   05225 Hepatocellular carcinoma
    110561197 (Tgfb1)
   05226 Gastric cancer
    110561197 (Tgfb1)
   05220 Chronic myeloid leukemia
    110561197 (Tgfb1)
   05211 Renal cell carcinoma
    110561197 (Tgfb1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110561197 (Tgfb1)
   05321 Inflammatory bowel disease
    110561197 (Tgfb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110561197 (Tgfb1)
   05414 Dilated cardiomyopathy
    110561197 (Tgfb1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110561197 (Tgfb1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110561197 (Tgfb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110561197 (Tgfb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110561197 (Tgfb1)
   05161 Hepatitis B
    110561197 (Tgfb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110561197 (Tgfb1)
   05144 Malaria
    110561197 (Tgfb1)
   05145 Toxoplasmosis
    110561197 (Tgfb1)
   05140 Leishmaniasis
    110561197 (Tgfb1)
   05142 Chagas disease
    110561197 (Tgfb1)
Chaperones and folding catalysts [BR:mun03110]
 Intramolecular chaperones
  Others
   110561197 (Tgfb1)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110561197 (Tgfb1)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110561197 (Tgfb1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110561197
NCBI-ProteinID: XP_021513182
LinkDB
Position
Unknown
AA seq 390 aa
MPPSGLRLLPLLLPLPWLLVLTPGRPAAGLSTCKTVDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMVDRNNAI
YEKTKGISHSVYMFFNTSDIREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNNSWR
YLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNVLHVEINGIS
PKRRGDLASIHDMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctgctgccgcttctgctcccgctcccgtggctgctagtg
ctgacgcccgggaggccggccgcgggactctccacctgcaagacggtcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccttg
tacaacagcacccgcgaccgggtggccggcgagagcgcggacccggagcccgagcccgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaccgcaacaacgcaatc
tacgagaaaaccaaaggcatctcacacagtgtatatatgttcttcaacacgtcagacatc
cgggaagcggtgcccgagccaccactgctgtcccgggcagagctgcgcctgcagagattg
aagtccagtgtggagcagcatgtggaactgtaccagaaatacagcaacaattcctggcgt
taccttggtaaccggctgctgacccccaccgacacacctgagtggttgtcttttgacgtc
actggagttgtaaggcagtggctgaaccaaggagacggcatacagggctttcgcttcagc
gctcactgttcctgtgacagtaaagataatgtgctccacgtggagatcaatgggatcagc
cccaaacgtcgaggtgacctggcctccattcatgacatgaaccgacccttcctgctcctc
atggccaccccgctggaaagggcccagcacctccacagctccaggcaccggagagccctg
gacaccaactactgcttcagctccacggagaagaactgctgtgtgcggcagctgtacata
gactttcggaaggacctgggctggaagtggatccacgagcccaagggctaccacgccaac
ttctgtctggggccctgcccctacatttggagtcttgatacacagtacagtaaggtcctt
gccctctacaaccaacacaacccgggcgcttcggcgtcgccgtgctgcgtgccgcaggcg
ctggagccgctgccgatcgtctactacgtgggccgcaagcccaaggtggagcagctctcc
aacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system