KEGG   Meriones unguiculatus (Mongolian gerbil): 110549347
Entry
110549347         CDS       T05884                                 

Gene name
Rela
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01523  Antifolate resistance
mun04010  MAPK signaling pathway
mun04014  Ras signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04064  NF-kappa B signaling pathway
mun04066  HIF-1 signaling pathway
mun04071  Sphingolipid signaling pathway
mun04137  Mitophagy - animal
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04211  Longevity regulating pathway
mun04218  Cellular senescence
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04668  TNF signaling pathway
mun04722  Neurotrophin signaling pathway
mun04917  Prolactin signaling pathway
mun04920  Adipocytokine signaling pathway
mun04926  Relaxin signaling pathway
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05010  Alzheimer disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05030  Cocaine addiction
mun05132  Salmonella infection
mun05133  Pertussis
mun05134  Legionellosis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05203  Viral carcinogenesis
mun05212  Pancreatic cancer
mun05215  Prostate cancer
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05222  Small cell lung cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05321  Inflammatory bowel disease
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110549347 (Rela)
   04014 Ras signaling pathway
    110549347 (Rela)
   04064 NF-kappa B signaling pathway
    110549347 (Rela)
   04668 TNF signaling pathway
    110549347 (Rela)
   04066 HIF-1 signaling pathway
    110549347 (Rela)
   04071 Sphingolipid signaling pathway
    110549347 (Rela)
   04024 cAMP signaling pathway
    110549347 (Rela)
   04151 PI3K-Akt signaling pathway
    110549347 (Rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110549347 (Rela)
  09143 Cell growth and death
   04210 Apoptosis
    110549347 (Rela)
   04218 Cellular senescence
    110549347 (Rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110549347 (Rela)
   04621 NOD-like receptor signaling pathway
    110549347 (Rela)
   04622 RIG-I-like receptor signaling pathway
    110549347 (Rela)
   04623 Cytosolic DNA-sensing pathway
    110549347 (Rela)
   04625 C-type lectin receptor signaling pathway
    110549347 (Rela)
   04660 T cell receptor signaling pathway
    110549347 (Rela)
   04658 Th1 and Th2 cell differentiation
    110549347 (Rela)
   04659 Th17 cell differentiation
    110549347 (Rela)
   04657 IL-17 signaling pathway
    110549347 (Rela)
   04662 B cell receptor signaling pathway
    110549347 (Rela)
   04062 Chemokine signaling pathway
    110549347 (Rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110549347 (Rela)
   04917 Prolactin signaling pathway
    110549347 (Rela)
   04926 Relaxin signaling pathway
    110549347 (Rela)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110549347 (Rela)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110549347 (Rela)
  09149 Aging
   04211 Longevity regulating pathway
    110549347 (Rela)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110549347 (Rela)
   05202 Transcriptional misregulation in cancer
    110549347 (Rela)
   05203 Viral carcinogenesis
    110549347 (Rela)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110549347 (Rela)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110549347 (Rela)
   05221 Acute myeloid leukemia
    110549347 (Rela)
   05220 Chronic myeloid leukemia
    110549347 (Rela)
   05215 Prostate cancer
    110549347 (Rela)
   05222 Small cell lung cancer
    110549347 (Rela)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110549347 (Rela)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110549347 (Rela)
   05022 Pathways of neurodegeneration - multiple diseases
    110549347 (Rela)
  09165 Substance dependence
   05030 Cocaine addiction
    110549347 (Rela)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110549347 (Rela)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110549347 (Rela)
   04931 Insulin resistance
    110549347 (Rela)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110549347 (Rela)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110549347 (Rela)
   05135 Yersinia infection
    110549347 (Rela)
   05133 Pertussis
    110549347 (Rela)
   05134 Legionellosis
    110549347 (Rela)
   05152 Tuberculosis
    110549347 (Rela)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110549347 (Rela)
   05170 Human immunodeficiency virus 1 infection
    110549347 (Rela)
   05162 Measles
    110549347 (Rela)
   05164 Influenza A
    110549347 (Rela)
   05161 Hepatitis B
    110549347 (Rela)
   05160 Hepatitis C
    110549347 (Rela)
   05168 Herpes simplex virus 1 infection
    110549347 (Rela)
   05163 Human cytomegalovirus infection
    110549347 (Rela)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110549347 (Rela)
   05169 Epstein-Barr virus infection
    110549347 (Rela)
   05165 Human papillomavirus infection
    110549347 (Rela)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110549347 (Rela)
   05145 Toxoplasmosis
    110549347 (Rela)
   05140 Leishmaniasis
    110549347 (Rela)
   05142 Chagas disease
    110549347 (Rela)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    110549347 (Rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110549347 (Rela)
Transcription factors [BR:mun03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    110549347 (Rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 110549347
NCBI-ProteinID: XP_021494126
LinkDB
Position
Unknown
AA seq 550 aa
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPSRSSPSVSKPAPQPYAFPASLSTINF
DEFSPMVLPSGQISNQALALAPSSAPILAQTLVPSSAMVPALAQPPAPVTVLAPGPPQAL
ATAVPKTTQAGEGTLSEALLQLQFDADEDLGALLGSSTDPGVFTDLASVDNSEFQQLLNQ
GVSMSHPAAEPMLMEYPEAITRLVTGSQRPPDPAPTALGTTGLPNGLAGDEDFSSIADMD
FSALLSQISS
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggacgatctgtttcccctcatcttcccctcagagccagcccaggcttctgggccttat
gtggagatcattgagcagcccaaacagcggggcatgcggttccgctacaagtgcgagggt
cgctcagcgggtagtattcctggcgagagaagcacagataccaccaagacacaccccacc
atcaagatcaatggctacactggaccaggaacagttcgcatctccctggtcactaaggac
ccacctcaccggcctcatccacatgaactggtggggaaggactgcagggatggtttctac
gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt
gtgaagaagcgagacctggagcaagccattagccagcgcatccagaccaacaataacccc
tttcaagttcccattgaggagcagcggggggactatgatctgaacgcagtccgcctctgc
ttccaggtgacagtgcgggacccgtcaggcaggcccctccgcctgccgcctgtcctctct
catcctatttttgataaccgcgcccccaacactgccgagctcaagatctgccgagtaaac
cggaactccgggagctgccttggtggggatgagatcttcttgctgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacggggccgggctgggaggcacgaggctccttttct
caagctgatgtgcaccggcaagtggccattgtgttccggacccctccatacgccgacccc
agcctgcaggctccggtgcgcgtctccatgcagctccggcggccttctgatcgggagctt
agtgagcccatggagttccagtacctaccagacacagatgaccgccaccggattgaagag
aaacgcaaaaggacctatgagaccttcaagagcatcatgaagaagagtcctttcaatgga
ccgactgaaccccggcctccaacccggcgtattgccgtgccttccagaagctctccttct
gtctccaagccagccccgcagccctatgccttcccagcgtccctcagtaccatcaacttt
gatgagttttcccccatggtgttaccatctgggcagatctcaaaccaggccttggccttg
gcaccatcctctgcccccatcttggcccagaccttggtcccctcctcagccatggtacca
gctctggctcagcccccagcccctgtcacagttctcgccccaggtcctccccaagccctg
gccacagctgttccaaagaccacccaggcgggggagggcacactgtctgaagcgctgctg
cagctgcagttcgatgctgatgaagacttgggggccttgcttggcagcagcacagacccg
ggcgtgttcacagacctggcatctgtcgacaactcagagtttcagcagctcctgaaccag
ggtgtgtccatgtcacaccccgcagctgagcccatgctgatggagtaccccgaagctata
actcgcctggtgacagggtctcagaggccccctgacccagctcccacagccctggggacc
acagggcttcccaatggcctagctggggatgaagacttctcctccattgcggacatggac
ttctcagctcttttgagtcagatcagctcctaa

DBGET integrated database retrieval system