KEGG   Meriones unguiculatus (Mongolian gerbil): 110549441
Entry
110549441         CDS       T05884                                 

Gene name
Cd40
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 5 isoform X1
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04064  NF-kappa B signaling pathway
mun04514  Cell adhesion molecules
mun04620  Toll-like receptor signaling pathway
mun04672  Intestinal immune network for IgA production
mun05144  Malaria
mun05145  Toxoplasmosis
mun05166  Human T-cell leukemia virus 1 infection
mun05169  Epstein-Barr virus infection
mun05202  Transcriptional misregulation in cancer
mun05310  Asthma
mun05320  Autoimmune thyroid disease
mun05322  Systemic lupus erythematosus
mun05330  Allograft rejection
mun05340  Primary immunodeficiency
mun05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    110549441 (Cd40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110549441 (Cd40)
   04514 Cell adhesion molecules
    110549441 (Cd40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110549441 (Cd40)
   04672 Intestinal immune network for IgA production
    110549441 (Cd40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110549441 (Cd40)
  09163 Immune disease
   05310 Asthma
    110549441 (Cd40)
   05322 Systemic lupus erythematosus
    110549441 (Cd40)
   05320 Autoimmune thyroid disease
    110549441 (Cd40)
   05330 Allograft rejection
    110549441 (Cd40)
   05340 Primary immunodeficiency
    110549441 (Cd40)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110549441 (Cd40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110549441 (Cd40)
   05169 Epstein-Barr virus infection
    110549441 (Cd40)
  09174 Infectious disease: parasitic
   05144 Malaria
    110549441 (Cd40)
   05145 Toxoplasmosis
    110549441 (Cd40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mun04050]
    110549441 (Cd40)
   04090 CD molecules [BR:mun04090]
    110549441 (Cd40)
Cytokine receptors [BR:mun04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   110549441 (Cd40)
CD molecules [BR:mun04090]
 Proteins
  110549441 (Cd40)
SSDB
Motif
Pfam: TNFR_c6 Glycophorin_A
Other DBs
NCBI-GeneID: 110549441
NCBI-ProteinID: XP_021494312
LinkDB
Position
Unknown
AA seq 297 aa
MVPLPQQCALWSCLLTLVHLGQCITCSDRQYLSDGRCCDLCKPGTRLENDCTELEATTCI
PCNSGEFSASWNRELRCHQHRHCELNQGFRVKKEGTSDTDTVCTCKEGQHCTSQDCEACA
QHTACGPGFGVEQMATETTDTVCKPCLVGFFSNGSSPFEKCHPWTSCEAKGLMVLREGSS
QTDVLCGESRGDQDRVQIPSFQLRERALLVIPIVMAILILSTIFVVSVYIKKVAKKPTDN
RDIPLEVGGQIPEEIEDYPGHNTAPPVQETLHGCQPVAQEDGKESRISVQERQATWA
NT seq 894 nt   +upstreamnt  +downstreamnt
atggtgcctctgcctcagcagtgcgcgctctggagctgcttgctgacattggtccaccta
ggacaatgcatcacatgcagcgacagacagtacctttccgatggccgctgctgcgatttg
tgtaagccagggacgagactggagaacgactgcacagaacttgaggcgaccacatgcatc
ccgtgcaactcaggcgaattctcagccagctggaacagagagctgcgctgtcaccagcac
agacactgtgaactcaatcaagggtttcgggttaagaaggagggcacgtcagatacagac
accgtttgcacctgtaaggaaggtcagcactgcaccagccaggactgtgaggcctgtgcg
cagcacacagcctgtggccctggctttggagttgagcagatggccacagagaccacggat
actgtgtgtaagccctgcctggttggcttcttctccaatgggtcatcgcctttcgaaaag
tgtcatccttggacaagctgtgaggccaaagggctgatggttctgagggaaggatcgagt
caaactgatgtgctctgtggtgagtccaggggagaccaggaccgggtccaaataccgagt
ttccagctccgggagcgagcccttctggtcattcccatcgtgatggccatcctcatcctc
agcaccatctttgtggtgtctgtctatatcaaaaaggtggccaagaaaccaacggataat
agggacataccccttgaagttggagggcaaattccagaagagatagaggattatcctggt
cacaacactgctcctccggtgcaggaaacattgcatgggtgtcagcctgtcgcacaggag
gatggcaaagagagtcgcatctcagtgcaggagaggcaggcgacgtgggcgtga

DBGET integrated database retrieval system