KEGG   Meriones unguiculatus (Mongolian gerbil): 110549743
Entry
110549743         CDS       T05884                                 

Gene name
Cryl1
Definition
(RefSeq) lambda-crystallin homolog
  KO
K13247  L-gulonate 3-dehydrogenase [EC:1.1.1.45]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00040  Pentose and glucuronate interconversions
mun01100  Metabolic pathways
Module
mun_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110549743 (Cryl1)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.45  L-gulonate 3-dehydrogenase
     110549743 (Cryl1)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH 2-Hacid_dh_C UDPG_MGDP_dh_N NAD_Gly3P_dh_N NAD_binding_2 Pyr_redox
Other DBs
NCBI-GeneID: 110549743
NCBI-ProteinID: XP_021494743
LinkDB
Position
Unknown
AA seq 319 aa
MASPAAGGVVIVGSGLIGRSWAMLFASGGFKVKLYDVEQQQITNALENIRKEMTLLEQSG
SLKGSLSAEQQLSLISGCGNLAEAVEGAMHIQECVPENLDLKRKIFAQLDRIVDERVVLS
SSSSCLLPSKLFTGVAHVKQCLVAHPVNPPYYVPLVELVPHPETAPATMDRTYALMRKIG
QSPVRVLKEIDGFVLNRLQYAIISEAWRLVEEGIVSPNDLDLVMSDGLGMRYAFIGPLET
MHLNAEGMVSYCDRYSEGMKRVLKTFGPVPEFSGATVEKVNQDMCMKVPDDPEHLAARRQ
WRDDCLMKLAKLKHQVQPQ
NT seq 960 nt   +upstreamnt  +downstreamnt
atggcgtctcctgcagcgggcggggtggtgatcgtaggcagtggactcattggtcggagc
tgggctatgctctttgctagtggaggcttcaaggtaaagctctatgacgtcgagcagcag
cagataacaaacgccctggaaaacatcaggaaggagatgacattgctggagcagtcgggt
tctctcaaaggctccttgagtgcagagcagcagctgtcgctcatcagtggctgtggcaat
ctagcagaagcagtagagggcgccatgcacattcaggagtgtgtcccggagaacctggac
ctgaaaaggaagatttttgcccagctggaccgcatcgtggacgaaagggtcgtcttgagc
agctccagctcgtgcctgctgccttccaagctgttcacgggcgtggcccacgtgaagcag
tgcctcgtggctcatccggtcaatccaccatattatgtcccactggttgagctggtccct
cacccagagacagcaccagccacgatggacagaacctatgccttgatgaggaagattgga
cagtccccagtgagagtcctgaaggagatcgatggcttcgtcctgaaccgcctgcagtat
gcaatcattagtgaggcctggaggctggtggaggaaggaatagtatctcctaacgacctg
gacctggtcatgtcagatgggctgggcatgcgctatgcattcattggacccttggagacg
atgcacctcaatgctgaaggtatggtgagctactgtgacagatacagtgaaggaatgaag
cgcgtcctcaagacttttggacctgttccagagttctcaggggccacagtggagaaagtt
aaccaggacatgtgcatgaaggttcctgatgacccggagcacttagctgccagaaggcag
tggagggacgattgtctcatgaagctcgccaaactgaagcaccaggtgcaaccgcagtaa

DBGET integrated database retrieval system