KEGG   Meriones unguiculatus (Mongolian gerbil): 110550083
Entry
110550083         CDS       T05884                                 

Gene name
Bcl2l1
Definition
(RefSeq) bcl-2-like protein 1 isoform X1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01524  Platinum drug resistance
mun04014  Ras signaling pathway
mun04064  NF-kappa B signaling pathway
mun04115  p53 signaling pathway
mun04137  Mitophagy - animal
mun04140  Autophagy - animal
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04621  NOD-like receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun05012  Parkinson disease
mun05014  Amyotrophic lateral sclerosis
mun05022  Pathways of neurodegeneration - multiple diseases
mun05145  Toxoplasmosis
mun05162  Measles
mun05166  Human T-cell leukemia virus 1 infection
mun05168  Herpes simplex virus 1 infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05202  Transcriptional misregulation in cancer
mun05212  Pancreatic cancer
mun05220  Chronic myeloid leukemia
mun05222  Small cell lung cancer
mun05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110550083 (Bcl2l1)
   04630 JAK-STAT signaling pathway
    110550083 (Bcl2l1)
   04064 NF-kappa B signaling pathway
    110550083 (Bcl2l1)
   04151 PI3K-Akt signaling pathway
    110550083 (Bcl2l1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110550083 (Bcl2l1)
   04137 Mitophagy - animal
    110550083 (Bcl2l1)
  09143 Cell growth and death
   04210 Apoptosis
    110550083 (Bcl2l1)
   04215 Apoptosis - multiple species
    110550083 (Bcl2l1)
   04115 p53 signaling pathway
    110550083 (Bcl2l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110550083 (Bcl2l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110550083 (Bcl2l1)
   05202 Transcriptional misregulation in cancer
    110550083 (Bcl2l1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110550083 (Bcl2l1)
   05225 Hepatocellular carcinoma
    110550083 (Bcl2l1)
   05220 Chronic myeloid leukemia
    110550083 (Bcl2l1)
   05222 Small cell lung cancer
    110550083 (Bcl2l1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110550083 (Bcl2l1)
   05014 Amyotrophic lateral sclerosis
    110550083 (Bcl2l1)
   05022 Pathways of neurodegeneration - multiple diseases
    110550083 (Bcl2l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110550083 (Bcl2l1)
   05170 Human immunodeficiency virus 1 infection
    110550083 (Bcl2l1)
   05162 Measles
    110550083 (Bcl2l1)
   05168 Herpes simplex virus 1 infection
    110550083 (Bcl2l1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110550083 (Bcl2l1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110550083 (Bcl2l1)
   01524 Platinum drug resistance
    110550083 (Bcl2l1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110550083 (Bcl2l1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mun03036]
    110550083 (Bcl2l1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mun02000]
    110550083 (Bcl2l1)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110550083 (Bcl2l1)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110550083 (Bcl2l1)
Transporters [BR:mun02000]
 Other transporters
  Pores ion channels [TC:1]
   110550083 (Bcl2l1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 110550083
NCBI-ProteinID: XP_021495377
LinkDB
Position
Unknown
AA seq 234 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLA
DSRAVNGATGHSSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFNDLTSQLHITPGTA
YQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLE
PWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 705 nt   +upstreamnt  +downstreamnt
atgtctcagagtaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtcgaagagaacaggactgaggccccagaagga
actgaatcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg
gacagccgggcagtgaatggagccactggccacagcagcagcagtttggatgcacgggag
gtgatccccatggcagcagtgaaacaagcgctgagagaggctggtgatgagtttgaactt
cggtaccggcgggcattcaatgatctaacatcccagcttcatataaccccagggacagca
tatcagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgc
attgtggcctttttctccttcggtggggcactgtgtgtggaaagcgtagacaaggagatg
caggtattggtgagtcggatcgcaagttggatggccacctacctgaatgaccacctagag
ccttggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgca
gcagccgagagccgaaaaggccaggagcgtttcaaccgctggttcctgacgggcatgact
gtggctggtgtggttctgctgggctcactcttcagtcggaagtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110557800
Entry
110557800         CDS       T05884                                 

Gene name
Bcl2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04064  NF-kappa B signaling pathway
mun04066  HIF-1 signaling pathway
mun04071  Sphingolipid signaling pathway
mun04115  p53 signaling pathway
mun04140  Autophagy - animal
mun04141  Protein processing in endoplasmic reticulum
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04261  Adrenergic signaling in cardiomyocytes
mun04340  Hedgehog signaling pathway
mun04510  Focal adhesion
mun04621  NOD-like receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04722  Neurotrophin signaling pathway
mun04725  Cholinergic synapse
mun04915  Estrogen signaling pathway
mun04928  Parathyroid hormone synthesis, secretion and action
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun05014  Amyotrophic lateral sclerosis
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05162  Measles
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05206  MicroRNAs in cancer
mun05210  Colorectal cancer
mun05215  Prostate cancer
mun05222  Small cell lung cancer
mun05226  Gastric cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110557800 (Bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110557800 (Bcl2)
   04630 JAK-STAT signaling pathway
    110557800 (Bcl2)
   04064 NF-kappa B signaling pathway
    110557800 (Bcl2)
   04066 HIF-1 signaling pathway
    110557800 (Bcl2)
   04071 Sphingolipid signaling pathway
    110557800 (Bcl2)
   04151 PI3K-Akt signaling pathway
    110557800 (Bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110557800 (Bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    110557800 (Bcl2)
   04215 Apoptosis - multiple species
    110557800 (Bcl2)
   04217 Necroptosis
    110557800 (Bcl2)
   04115 p53 signaling pathway
    110557800 (Bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110557800 (Bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110557800 (Bcl2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110557800 (Bcl2)
   04928 Parathyroid hormone synthesis, secretion and action
    110557800 (Bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110557800 (Bcl2)
  09156 Nervous system
   04725 Cholinergic synapse
    110557800 (Bcl2)
   04722 Neurotrophin signaling pathway
    110557800 (Bcl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110557800 (Bcl2)
   05206 MicroRNAs in cancer
    110557800 (Bcl2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110557800 (Bcl2)
   05226 Gastric cancer
    110557800 (Bcl2)
   05215 Prostate cancer
    110557800 (Bcl2)
   05222 Small cell lung cancer
    110557800 (Bcl2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110557800 (Bcl2)
   05022 Pathways of neurodegeneration - multiple diseases
    110557800 (Bcl2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110557800 (Bcl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110557800 (Bcl2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110557800 (Bcl2)
   05152 Tuberculosis
    110557800 (Bcl2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110557800 (Bcl2)
   05161 Hepatitis B
    110557800 (Bcl2)
   05162 Measles
    110557800 (Bcl2)
   05168 Herpes simplex virus 1 infection
    110557800 (Bcl2)
   05169 Epstein-Barr virus infection
    110557800 (Bcl2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110557800 (Bcl2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110557800 (Bcl2)
   01524 Platinum drug resistance
    110557800 (Bcl2)
   01522 Endocrine resistance
    110557800 (Bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110557800 (Bcl2)
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110557800 (Bcl2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 110557800
NCBI-ProteinID: XP_021508081
LinkDB
Position
Unknown
AA seq 199 aa
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADTAPLGAATTPGIFSSQPESNPTPA
VHRDTAARMSPPGPLVATAGPVLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNG
NLHAWIQDNGGWVGARMAE
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtatatccat
tataagctgtcacagaggggctacgagtgggacgcaggagacgcggacaccgcgcccctg
ggggccgccaccacccctggcatcttctcctcccagcctgagagcaacccaacgcccgct
gtgcaccgggacactgctgccaggatgtcgcctccagggcccctggtcgccactgctggg
cctgtgctcagccctgtgccacctgtggtccacctgaccctccgccgggctggggatgac
ttctcccggcgctaccgtcgcgacttcgcagagatgtccagtcagctgcacctgacgccc
ttcaccgcgagaggacgctttgccacggtggtggaggaactcttcagggatggggtgaac
tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac
agggagatgtcacccctggtggacaatatagccctgtggatgactgagtacctgaacggg
aatcttcacgcctggatccaggataacggaggctgggtaggtgcacgtatggctgaatga

DBGET integrated database retrieval system