Meriones unguiculatus (Mongolian gerbil): 110550083 Help Entry 110550083         CDS       T05884                                  Gene name Bcl2l1 Definition (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mun  Meriones unguiculatus (Mongolian gerbil) Pathway mun01521   EGFR tyrosine kinase inhibitor resistance mun01524   Platinum drug resistance mun04014   Ras signaling pathway mun04064   NF-kappa B signaling pathway mun04115   p53 signaling pathway mun04137   Mitophagy - animal mun04140   Autophagy - animal mun04151   PI3K-Akt signaling pathway mun04210   Apoptosis mun04215   Apoptosis - multiple species mun04621   NOD-like receptor signaling pathway mun04630   JAK-STAT signaling pathway mun05012   Parkinson disease mun05014   Amyotrophic lateral sclerosis mun05022   Pathways of neurodegeneration - multiple diseases mun05145   Toxoplasmosis mun05162   Measles mun05166   Human T-cell leukemia virus 1 infection mun05168   Herpes simplex virus 1 infection mun05170   Human immunodeficiency virus 1 infection mun05200   Pathways in cancer mun05202   Transcriptional misregulation in cancer mun05212   Pancreatic cancer mun05220   Chronic myeloid leukemia mun05222   Small cell lung cancer mun05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mun00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110550083 (Bcl2l1)    04630 JAK-STAT signaling pathway     110550083 (Bcl2l1)    04064 NF-kappa B signaling pathway     110550083 (Bcl2l1)    04151 PI3K-Akt signaling pathway     110550083 (Bcl2l1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110550083 (Bcl2l1)    04137 Mitophagy - animal     110550083 (Bcl2l1)   09143 Cell growth and death    04210 Apoptosis     110550083 (Bcl2l1)    04215 Apoptosis - multiple species     110550083 (Bcl2l1)    04115 p53 signaling pathway     110550083 (Bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110550083 (Bcl2l1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110550083 (Bcl2l1)    05202 Transcriptional misregulation in cancer     110550083 (Bcl2l1)   09162 Cancer: specific types    05212 Pancreatic cancer     110550083 (Bcl2l1)    05225 Hepatocellular carcinoma     110550083 (Bcl2l1)    05220 Chronic myeloid leukemia     110550083 (Bcl2l1)    05222 Small cell lung cancer     110550083 (Bcl2l1)   09164 Neurodegenerative disease    05012 Parkinson disease     110550083 (Bcl2l1)    05014 Amyotrophic lateral sclerosis     110550083 (Bcl2l1)    05022 Pathways of neurodegeneration - multiple diseases     110550083 (Bcl2l1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110550083 (Bcl2l1)    05170 Human immunodeficiency virus 1 infection     110550083 (Bcl2l1)    05162 Measles     110550083 (Bcl2l1)    05168 Herpes simplex virus 1 infection     110550083 (Bcl2l1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110550083 (Bcl2l1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110550083 (Bcl2l1)    01524 Platinum drug resistance     110550083 (Bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mun01009]     110550083 (Bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mun03036]     110550083 (Bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mun02000]     110550083 (Bcl2l1) Protein phosphatases and associated proteins [BR:mun01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      110550083 (Bcl2l1) Chromosome and associated proteins [BR:mun03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     110550083 (Bcl2l1) Transporters [BR:mun02000]  Other transporters   Pores ion channels [TC:1]    110550083 (Bcl2l1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  110550083 NCBI-ProteinID:  XP_021495377 LinkDB All DBs Position Unknown AA seq 234 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLA DSRAVNGATGHSSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFNDLTSQLHITPGTA YQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLE PWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagtaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtcgaagagaacaggactgaggccccagaagga actgaatcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccgggcagtgaatggagccactggccacagcagcagcagtttggatgcacgggag gtgatccccatggcagcagtgaaacaagcgctgagagaggctggtgatgagtttgaactt cggtaccggcgggcattcaatgatctaacatcccagcttcatataaccccagggacagca tatcagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgc attgtggcctttttctccttcggtggggcactgtgtgtggaaagcgtagacaaggagatg caggtattggtgagtcggatcgcaagttggatggccacctacctgaatgaccacctagag ccttggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgca gcagccgagagccgaaaaggccaggagcgtttcaaccgctggttcctgacgggcatgact gtggctggtgtggttctgctgggctcactcttcagtcggaagtga

Meriones unguiculatus (Mongolian gerbil): 110557800 Help Entry 110557800         CDS       T05884                                  Gene name Bcl2 Definition (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism mun  Meriones unguiculatus (Mongolian gerbil) Pathway mun01521   EGFR tyrosine kinase inhibitor resistance mun01522   Endocrine resistance mun01524   Platinum drug resistance mun04064   NF-kappa B signaling pathway mun04066   HIF-1 signaling pathway mun04071   Sphingolipid signaling pathway mun04115   p53 signaling pathway mun04140   Autophagy - animal mun04141   Protein processing in endoplasmic reticulum mun04151   PI3K-Akt signaling pathway mun04210   Apoptosis mun04215   Apoptosis - multiple species mun04217   Necroptosis mun04261   Adrenergic signaling in cardiomyocytes mun04340   Hedgehog signaling pathway mun04510   Focal adhesion mun04621   NOD-like receptor signaling pathway mun04630   JAK-STAT signaling pathway mun04722   Neurotrophin signaling pathway mun04725   Cholinergic synapse mun04915   Estrogen signaling pathway mun04928   Parathyroid hormone synthesis, secretion and action mun04933   AGE-RAGE signaling pathway in diabetic complications mun05014   Amyotrophic lateral sclerosis mun05022   Pathways of neurodegeneration - multiple diseases mun05132   Salmonella infection mun05145   Toxoplasmosis mun05152   Tuberculosis mun05161   Hepatitis B mun05162   Measles mun05168   Herpes simplex virus 1 infection mun05169   Epstein-Barr virus infection mun05170   Human immunodeficiency virus 1 infection mun05200   Pathways in cancer mun05206   MicroRNAs in cancer mun05210   Colorectal cancer mun05215   Prostate cancer mun05222   Small cell lung cancer mun05226   Gastric cancer mun05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mun00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110557800 (Bcl2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     110557800 (Bcl2)    04630 JAK-STAT signaling pathway     110557800 (Bcl2)    04064 NF-kappa B signaling pathway     110557800 (Bcl2)    04066 HIF-1 signaling pathway     110557800 (Bcl2)    04071 Sphingolipid signaling pathway     110557800 (Bcl2)    04151 PI3K-Akt signaling pathway     110557800 (Bcl2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110557800 (Bcl2)   09143 Cell growth and death    04210 Apoptosis     110557800 (Bcl2)    04215 Apoptosis - multiple species     110557800 (Bcl2)    04217 Necroptosis     110557800 (Bcl2)    04115 p53 signaling pathway     110557800 (Bcl2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     110557800 (Bcl2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110557800 (Bcl2)   09152 Endocrine system    04915 Estrogen signaling pathway     110557800 (Bcl2)    04928 Parathyroid hormone synthesis, secretion and action     110557800 (Bcl2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     110557800 (Bcl2)   09156 Nervous system    04725 Cholinergic synapse     110557800 (Bcl2)    04722 Neurotrophin signaling pathway     110557800 (Bcl2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110557800 (Bcl2)    05206 MicroRNAs in cancer     110557800 (Bcl2)   09162 Cancer: specific types    05210 Colorectal cancer     110557800 (Bcl2)    05226 Gastric cancer     110557800 (Bcl2)    05215 Prostate cancer     110557800 (Bcl2)    05222 Small cell lung cancer     110557800 (Bcl2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110557800 (Bcl2)    05022 Pathways of neurodegeneration - multiple diseases     110557800 (Bcl2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110557800 (Bcl2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110557800 (Bcl2)   09171 Infectious disease: bacterial    05132 Salmonella infection     110557800 (Bcl2)    05152 Tuberculosis     110557800 (Bcl2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110557800 (Bcl2)    05161 Hepatitis B     110557800 (Bcl2)    05162 Measles     110557800 (Bcl2)    05168 Herpes simplex virus 1 infection     110557800 (Bcl2)    05169 Epstein-Barr virus infection     110557800 (Bcl2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110557800 (Bcl2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110557800 (Bcl2)    01524 Platinum drug resistance     110557800 (Bcl2)    01522 Endocrine resistance     110557800 (Bcl2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mun01009]     110557800 (Bcl2) Protein phosphatases and associated proteins [BR:mun01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      110557800 (Bcl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  110557800 NCBI-ProteinID:  XP_021508081 LinkDB All DBs Position Unknown AA seq 199 aa AA seqDB search MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADTAPLGAATTPGIFSSQPESNPTPA VHRDTAARMSPPGPLVATAGPVLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNG NLHAWIQDNGGWVGARMAE NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtatatccat tataagctgtcacagaggggctacgagtgggacgcaggagacgcggacaccgcgcccctg ggggccgccaccacccctggcatcttctcctcccagcctgagagcaacccaacgcccgct gtgcaccgggacactgctgccaggatgtcgcctccagggcccctggtcgccactgctggg cctgtgctcagccctgtgccacctgtggtccacctgaccctccgccgggctggggatgac ttctcccggcgctaccgtcgcgacttcgcagagatgtccagtcagctgcacctgacgccc ttcaccgcgagaggacgctttgccacggtggtggaggaactcttcagggatggggtgaac tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac agggagatgtcacccctggtggacaatatagccctgtggatgactgagtacctgaacggg aatcttcacgcctggatccaggataacggaggctgggtaggtgcacgtatggctgaatga

DBGET integrated database retrieval system