KEGG   Meriones unguiculatus (Mongolian gerbil): 110550157
Entry
110550157         CDS       T05884                                 

Gene name
Nos2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00220  Arginine biosynthesis
mun00330  Arginine and proline metabolism
mun01100  Metabolic pathways
mun04020  Calcium signaling pathway
mun04066  HIF-1 signaling pathway
mun04146  Peroxisome
mun04371  Apelin signaling pathway
mun04926  Relaxin signaling pathway
mun05010  Alzheimer disease
mun05014  Amyotrophic lateral sclerosis
mun05022  Pathways of neurodegeneration - multiple diseases
mun05133  Pertussis
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05146  Amoebiasis
mun05152  Tuberculosis
mun05200  Pathways in cancer
mun05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    110550157 (Nos2)
   00330 Arginine and proline metabolism
    110550157 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110550157 (Nos2)
   04066 HIF-1 signaling pathway
    110550157 (Nos2)
   04020 Calcium signaling pathway
    110550157 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110550157 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110550157 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110550157 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    110550157 (Nos2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110550157 (Nos2)
   05014 Amyotrophic lateral sclerosis
    110550157 (Nos2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110550157 (Nos2)
   05152 Tuberculosis
    110550157 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110550157 (Nos2)
   05145 Toxoplasmosis
    110550157 (Nos2)
   05140 Leishmaniasis
    110550157 (Nos2)
   05142 Chagas disease
    110550157 (Nos2)
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     110550157 (Nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 110550157
NCBI-ProteinID: XP_021495494
LinkDB
Position
Unknown
AA seq 1151 aa
MTCPWKSFFRIKSKGNLKEEKDINNNVGKAPVAVAVLSLTTQDDLKSHRPAKHQNGSPQP
LTGTTQNVPKSLDKVHVPPSTRPQHVKIKNWGSGEILQDTLHHKATSDFTCRSKSCLGSI
MNPKNLTRGPRDKPTSLEELLPQAIEFINQYYGSFKEAKIEEHLARVEAVTKEIETTGTY
QLTLDELIFATKLAWRNAPRCIGRIQWANLQVFDARSCSTAQDMFQHICRHVLYATNNGN
IRSAITVFPQRSDGKHDFRIWNSQLIRYAGYQMPDGTIRGDPANLEFTQLCIDLGWKPRH
GRFDVLPLVLQADGRDPEVFEIPPDLVLEVNMEHPKYEWFQELGLKWYALPAVANMLLEV
GGLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEIN
VAVLHSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQE
MLNYVLSPFYYYQIEPWKTHVWQDGTLRPRRREIRFRVLVKVVLFASVLMRKVMASRVRA
TVLFATETGKSEALAQDLAALFSYAFNTKVVCMSQYKASSLEEEQLLLVVTSTFGNGDCP
SNGQTLKKSLFMLRELTHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLAPTGEG
DELSGQEDAFRSWAVQTFRAACETFNVRSKHHIQIPKRYTSNTVWEAQQYRLTQSPEPFD
LNKALSSIHAKNVFTMRLKSQQNLQSGKSSRTTLLVQLSFEGSRGPSYLPGEHLGIFPGN
QTALVQGILERVVDCPEPHQTVCLEVMDEKGSYWVRDKRLPPCSLSQALTYFLDITTPPT
QLQLHKLARLATEEADRRKLEALCQPSEYNGWKLSNSPTFLEVLEEFPSLRVPASFLLSQ
LPLLKPRYYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWISSLKPQDPVPC
FVRSVSGFQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDSQHKGLKGGRMTLVFGCRHP
EEDHLYREEMQEMVRQGVLHQVHTGCSRLPGKPKVYVQDILQKQLASEVLSVLHAEQGHL
YVCGDVRMARDVAATVKKLVATQLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFSYGVKKA
SALEQPKSTRL
NT seq 3456 nt   +upstreamnt  +downstreamnt
atgacctgcccctggaagtctttcttcagaatcaaatcaaaaggcaacttgaaggaggaa
aaggacattaacaacaatgtggggaaagcccccgtggccgtggccgttctcagcctaaca
acacaggatgaccttaagagtcacagacctgccaagcaccaaaacggttctccccagccc
ctcactgggacaacacagaatgttccaaaatccctggacaaggtgcacgtgcctccatcg
acccgcccacagcatgtgaagatcaaaaactggggcagtggagagattttgcaagacacc
cttcaccacaaggctacgtcggatttcacttgcaggtctaaatcttgcttggggtccatc
atgaaccccaagaatttgaccagagggcccagagataagcccacgtcactggaggagctt
ctgcctcaagccattgagttcatcaaccagtattatggctccttcaaagaggcaaaaata
gaggaacatctggccagggtggaagctgtaacaaaggagatagaaacaacaggaacctac
cagctgacgctggatgagctcatcttcgccaccaagctagcctggaggaacgccccccgc
tgcattggcaggatccagtgggccaacctgcaggtctttgatgcccgcagctgtagcact
gcccaggacatgtttcagcatatctgcagacatgtgctttacgccaccaacaacggcaac
atcaggtcggccatcaccgtgttcccccagcggagcgatgggaagcatgacttccggatc
tggaattcgcagctcatccggtacgcgggctaccagatgcccgatggcaccatcaggggg
gaccctgccaacttggagttcacccagctgtgcatcgacctgggctggaaaccccgccat
ggccgtttcgacgtgctgcctctggtcctgcaggccgacggtcgagatccagaggtcttt
gaaatccctcctgacctcgtgttggaggtgaacatggagcatcccaagtacgagtggttc
caggagctgggactgaagtggtacgcgcttcctgctgtagccaatatgctgctggaggtg
ggcggccttgaattcccagcctgccccttcaatggttggtacatgggcacggagatcgga
gttcgcgacttctgtgacacgcagcgctacaacatcctagaggaagtgggcaggaggatg
ggcctggagacccacacactggcctccctttggaaagaccgggctgtcacggagatcaat
gtggctgtgctccacagtttccagaagcagaatgtgaccatcatggaccaccacacagct
tcggagtccttcatgaagcacatgcagaatgagtaccgggcccgaggaggctgccctgca
gactggatttggctggtccccccagtgtccgggagcatcacccctgtgttccaccaggag
atgctcaactacgttctgtctccattctactactatcagatcgagccctggaagacccat
gtctggcaggatgggacgctgaggcccaggaggagagaaatccgtttcagagtcttggtg
aaagtggtgctctttgcttccgtgctgatgcgcaaggtcatggcttcccgggtcagagcc
acagtcctctttgctactgagacaggaaagtctgaagctctagcccaggacctggcagcc
ttgttcagctatgccttcaacaccaaggttgtctgcatgagccagtataaggcaagcagc
ttggaagaggagcaactgctgctggtggtgacaagtacttttgggaatggagactgcccc
agcaatgggcagaccctgaagaaatctctgttcatgctgagagagctcacccacaccttc
aggtatgctgtgttcggcttgggctccagcatgtaccctcagttttgcgccttcgctcac
gacatcgaccagaagctatcccagctgggagcctctcagcttgccccgacaggagaaggg
gacgagctcagcgggcaggaggatgccttccgcagctgggctgtgcaaaccttccgggcc
gcctgtgagacgtttaatgttcgaagcaaacatcacatccagattccaaaacgctacact
tccaacacagtttgggaggcacaacaatacaggctcacccagagcccagagccgttcgac
ctcaacaaagccctcagcagtatacatgccaagaacgtgttcaccatgaggctgaaatcc
cagcagaatctgcagagtgggaagtccagccgtaccaccctcctcgttcaactctccttc
gagggcagccgaggccccagctacctgcctggggaacaccttgggattttcccaggcaac
cagactgccctggtgcagggcatcttggagcgagttgtggattgtcccgagccacaccaa
actgtgtgcctggaggttatggatgagaaaggcagctactgggtcagagacaagaggctg
cctccctgctcgctcagccaggccctcacctacttcctggacatcactaccccacccacc
cagctgcagctgcacaagctggcccgcctagccacggaagaggccgacaggcggaagctg
gaggccttgtgtcagccctcagagtacaacggctggaagctgagcaacagccccacgttt
ctggaggtgctggaagagttcccgtcactgcgcgtgcctgcctccttcctgctctcacag
ctccccctactgaagccccgctactactccatcagctcgtcccaagaccacaccccctcg
gaggtccacctgactgtggccgtggtcacctaccgcacccgagatggtcagggtcccctg
caccatggtgtctgcagcacttggatcagtagcctgaagccccaggaccctgtgccctgt
ttcgtgcgaagcgtcagtggcttccagctcccggaggacccctcccagccttgcatcctc
attgggcctggcacgggcattgcccccttccgaagtttctggcagcagcggctccatgac
tcccaacacaaaggactcaaaggaggccgcatgaccttggtgtttgggtgccggcacccg
gaagaggaccacctctatcgagaagagatgcaggagatggtccgccagggagtgcttcac
caggttcacacaggctgctcccggctgcccggcaagcccaaggtctacgtccaagacatc
ctacagaagcagctggccagcgaggtcctcagcgtgctgcacgcagagcagggccacctc
tatgtctgcggagacgtgcgcatggcccgggatgtggccgccacggtgaagaagctggtg
gccacccagctgagcttgagcgaggagcaggttgaggactatttcttccagctcaagagc
cagaaacgttatcacgaagacatcttcggggcagtcttttcctatggggtgaaaaaggcc
agcgccttggagcagcccaaaagcacgaggctctga

DBGET integrated database retrieval system