KEGG   Meriones unguiculatus (Mongolian gerbil): 110550327
Entry
110550327         CDS       T05884                                 

Gene name
Ikbke
Definition
(RefSeq) LOW QUALITY PROTEIN: inhibitor of nuclear factor kappa-B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04623  Cytosolic DNA-sensing pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110550327 (Ikbke)
   04621 NOD-like receptor signaling pathway
    110550327 (Ikbke)
   04622 RIG-I-like receptor signaling pathway
    110550327 (Ikbke)
   04623 Cytosolic DNA-sensing pathway
    110550327 (Ikbke)
   04625 C-type lectin receptor signaling pathway
    110550327 (Ikbke)
   04657 IL-17 signaling pathway
    110550327 (Ikbke)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    110550327 (Ikbke)
   05160 Hepatitis C
    110550327 (Ikbke)
   05171 Coronavirus disease - COVID-19
    110550327 (Ikbke)
   05164 Influenza A
    110550327 (Ikbke)
   05162 Measles
    110550327 (Ikbke)
   05168 Herpes simplex virus 1 infection
    110550327 (Ikbke)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110550327 (Ikbke)
   05169 Epstein-Barr virus infection
    110550327 (Ikbke)
   05165 Human papillomavirus infection
    110550327 (Ikbke)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110550327 (Ikbke)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     110550327 (Ikbke)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   110550327 (Ikbke)
SSDB
Motif
Pfam: TBK1_CCD1 TBK1_ULD Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 110550327
NCBI-ProteinID: XP_021495811
LinkDB
Position
Unknown
AA seq 712 aa
MQSTTNYLWHTDDLLGQGATAGVYKAXNKKSGEVVALKVFNSTSYWQPPEVQVREPEILG
KLNHQNIVKLFAVEETVGSSQQKVLVMDYCSSGSLLSVLENPENTFGLPEEEFLVVLRCV
VAGMNHLRENGXLSTVNIMRLMGKEGXNIYKLSDFGAAQKLDDDEKFVSVYGTEEYLHPD
MYERAVLCKPQQKAFGMTVNLXSIVVTLYHAATGSLPYIPFGGPWHNKEIMYRITTEKPA
GAISGTQRQEDGPLEWNYSPVTCRLSMEGLQSQLVPILANILEIEQAKCWGFNQFFXSDI
LQQTIIHVFSLPQVVLHHVYIHAQNTISIFLEAVCEQTNVAPKQQEYLFEGHPCVLEPSL
SAQHVAHRIASSPLTLFSMASDTPKGLAFRDPALDIPKFVLKVDLQVDYSTAKGVLGAGY
QALWLAWVLLDGQALMLQGLCWVLEVLQNTCQQTLEVTRTALLLLSSSRGSERFNSGTRK
PHFXELKEATELRSKLQACSEVLSRCSHNVIETQMSLNCLGGELLKDQDQIHEDHRSIQK
IQCCLDKMCFIYKQFKKSRMRPGLIYNEEQIHKLEKXDFSHLAKRLLQVFQEECVQKYQV
LLVTHGKQIRQVQKAQNHLHLIGCSVAAYNSEAWEAQESLSKIFDQLLLDRASGQGAQVS
PQSMAPHPSPDSKDLVFQVQELCNDMKLLAFDLQDNNCLIEWLHRVPSAPDV
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgcagagtacaactaattacctttggcacactgatgaccttctagggcagggggccact
gctggtgtgtacaaggcctgaaacaagaaatcgggggaagtggttgctttaaaggtcttc
aattcaaccagctactggcagccccctgaggtgcaagtgagggagcctgaaatcctgggg
aaactgaatcatcagaacatcgtcaagctgttcgctgtggaggaaacagtgggaagcagc
cagcagaaggtgctggtgatggattattgctccagtgggagcctgctgagtgtgctggaa
aaccctgagaacacctttgggcttcctgaggaggagttcctggtggtactgcgctgtgtt
gtggctggcatgaaccacctgcgggagaacgggncattgtccaccgtgaatatcatgcgc
ctgatggggaaggaggggtagaacatctataagctgtctgacttcggggctgcccagaag
ctggacgatgatgagaagtttgtttctgtctatggtacagaagagtacctacaccctgac
atgtatgagcgggcagtgctttgcaaaccccagcaaaaggcgttcgggatgactgtgaat
ctctagagtattgtggtgaccctgtaccatgcagccactggtagtctgccctacatcccc
tttggtgggccctggcacaacaaggagatcatgtatagaatcaccacagagaagccagcc
ggggccatttcagggactcagaggcaggaagatgggcccctggagtggaactatagcccc
gtcacctgcagactgtccatggaagggctgcagagccagctagtgcccatcctagccaac
atcctggagatagaacaggctaagtgctggggcttcaatcagttctttngcagtgacatc
ctgcagcaaaccatcatccatgtcttctccctgccccaggtggtcttgcatcatgtctac
atccatgcccaaaacacgatttccatctttttggaggctgtatgtgagcagaccaacgtg
gcccccaaacaacaggagtatctctttgagggtcacccctgtgtccttgagccaagcctc
tcagcacagcacgtggcccacagaattgccagcagccctctgactctgttcagtatggcc
agtgatacacccaaggggctggccttcagagaccctgctctggacatcccaaagttcgtc
ctcaaggtcgacctacaggtagattacagcacagctaagggggtgctgggagctggctac
caggccctgtggctggcgtgggtcctgctggatgggcaggcattgatgcttcaagggtta
tgctgggtcctggaggtgcttcagaacacgtgccagcagacactagaggtcacacggaca
gcccttctcctcctcagcagcagtcggggctctgaaaggttcaacagtggtaccaggaaa
cctcacttctaggaactaaaggaggccacagagctgaggtccaagcttcaggcttgctca
gaggtcctctctagatgttcccacaatgttatagaaacccaaatgagcctgaactgcctg
ggtggagagcttttaaaggaccaggatcaaattcatgaggaccacagaagtatccagaag
atccagtgttgtttggacaagatgtgcttcatctacaaacagttcaagaaatctaggatg
aggccaggactcatctacaatgaggagcagatccacaagctggagaagtgagatttttct
catttagccaagaggctcctgcaggtgttccaggaggagtgtgtgcagaagtatcaggtg
ttgctggtcacacacggcaagcagataaggcaggttcagaaggcccagaaccacctgcac
ctcattggctgctctgtggctgcctataactcagaggcctgggaagctcaggagagcctg
agtaagatctttgatcagctccttctggacagagcttctggacagggggctcaggtctca
ccacaatccatggctccacatcccagccctgattcaaaggacttggtctttcaagtgcag
gagctttgtaatgatatgaagctattggcctttgatctccaggacaacaactgcctcatc
gaatggctacacagagtcccatcagcaccagatgtctga

DBGET integrated database retrieval system