KEGG   Meriones unguiculatus (Mongolian gerbil): 110550383Help
Entry
110550383         CDS       T05884                                 

Gene name
Gsto1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00480  Glutathione metabolism
mun00980  Metabolism of xenobiotics by cytochrome P450
mun00982  Drug metabolism - cytochrome P450
mun00983  Drug metabolism - other enzymes
mun01100  Metabolic pathways
mun01524  Platinum drug resistance
mun05200  Pathways in cancer
mun05204  Chemical carcinogenesis
mun05225  Hepatocellular carcinoma
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110550383 (Gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110550383 (Gsto1)
   00982 Drug metabolism - cytochrome P450
    110550383 (Gsto1)
   00983 Drug metabolism - other enzymes
    110550383 (Gsto1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110550383 (Gsto1)
   05204 Chemical carcinogenesis
    110550383 (Gsto1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110550383 (Gsto1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110550383 (Gsto1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110550383 (Gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mun02000]
    110550383 (Gsto1)
Enzymes [BR:mun01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110550383 (Gsto1)
Transporters [BR:mun02000]
 Other Transporters
  Pores ion channels [TC:1]
   110550383 (Gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 110550383
NCBI-ProteinID: XP_021495916
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MSGSSARSLGKGSAPPGPVPEGVIRVYSMRFCPFAQRTLMVLKAKGIRHEIVNINLKNKP
EWFFKKNPLGLVPVLENSQGHLISESVITCEYLDEAYPEKKLFPDDPYEKALQKMTFEQF
SKVPPLVASFIRAKRKEDHPGIKEELRREFSKLEEAMTNVKTAFFGGNSLSMIDYLIWPW
FQRLEALELNECISHTPKLKLWMAAMQKDPVASSHFIDAKTYRDYLSLYLQDSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggtcctccgccaggagcctggggaaaggaagcgcgcccccgggcccggtccca
gagggtgtgatccgcgtctacagcatgaggttctgccccttcgcgcagaggacgctgatg
gtcctgaaggccaagggaatccggcatgaaatcgtcaacatcaacctgaaaaacaagccc
gagtggttttttaagaagaatcccttggggctggtgccagttctggagaacagtcagggt
cacctgatttccgaatctgtcatcacttgtgagtacctggatgaggcttacccggaaaag
aagctgtttcccgatgacccttatgagaaagctctccagaagatgacctttgagcagttc
tctaaggtgccgccactggttgcaagctttattagggcaaagaggaaggaagaccatcct
ggaataaaagaagaattgaggagagaattcagcaagctggaggaggctatgactaatgtg
aagacagccttctttggtgggaattctctctctatgattgattatcttatttggccttgg
tttcaacgactagaagcactggaactcaatgagtgtatatcccacaccccaaaactcaag
ctctggatggcagccatgcagaaagaccctgtggcatcatcccacttcattgatgccaag
acctatcgtgattacttaagtctctacctacaggacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system